Mouse Mtfp1/1700020C11Rik/2610507A21Rik ORF/cDNA clone-Adenovirus plasmid (NM_026443)

Cat. No.: pGMAP-SPm-213
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Mtfp1/1700020C11Rik/2610507A21Rik adenoviral expression plasmid for Mtfp1 adenovirus packaging, Mtfp1 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-SPm-213
Gene Name Mtfp1
Accession Number NM_026443
Gene ID 67900
Species Mouse
Product Type Adenovirus plasmid (overexpression)
Insert Length 501 bp
Gene Alias 1700020C11Rik,2610507A21Rik,AV005788,Mtp18
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGGAGCAGCAGCGGCAGGGCGCCGAGCGCGACCTCTACCGGGACACGTGGGTGCGCTACCTGGGCTACGCCAATGAGGTGGGGGAGGCTTTCCGCTCGCTGGTTCCTGCAGCTGTGGTGTGGTTGAGCTATGGTGTGTCCAGCTCCTATGTCCTGGCCGATGCCATAGACAAAGGCAAGAAGGCAGGAGAGGTGCCAAGCCCTGAAGCAGGCCGCAACACCAGAATGGCCCTGGCTGTGGTCGACACCTTTGTGTGGCAGTCTCTGGCCTCTGTGGCTATCCCAGGCTTCACCATCAACCGTCTGTGTGCTGCCTCTCTCTATGTCTTGGGTACTATGACCCACTGGCCCCCGACTGTCCGCAAATGGACCACCACCACACTTGGACTGCTGGCCATCCCCGTCATAATCCACCCCATCGACAGGTCAGTGGACTTCCTCCTGGACTCTAGCCTGCGCAAGCTGTACCCGTCAGTGGAGAAGCCCAGCACCCCCTGA
ORF Protein Sequence MSEQQRQGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKGKKAGEVPSPEAGRNTRMALAVVDTFVWQSLASVAIPGFTINRLCAASLYVLGTMTHWPPTVRKWTTTTLGLLAIPVIIHPIDRSVDFLLDSSLRKLYPSVEKPSTP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMAP-SPm-213 Mouse Mtfp1 Adenovirus particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.