Mouse Bnip3/Nip3 ORF/cDNA clone-Adenovirus plasmid (NM_009760)
Cat. No.: pGMAP-SPm-231
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Mouse Bnip3/Nip3 adenoviral expression plasmid for Bnip3 adenovirus packaging, Bnip3 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Product Description
| Catalog ID | pGMAP-SPm-231 |
| Gene Name | Bnip3 |
| Accession Number | NM_009760 |
| Gene ID | 12176 |
| Species | Mouse |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 564 bp |
| Gene Alias | Nip3 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCGCAGAGCGGGGAGGAGAACCTGCAGGGCTCCTGGGTAGAACTGCACTTCAGCAATGGCAATGGGAGCAGCGTTCCAGCCTCCGTCTCTATTTATAATGGTGACATGGAAAAAATACTGTTGGATGCCCAGCATGAATCTGGACGAAGTAGCTCCAAGAGTTCTCACTGTGACAGCCCACCTCGCTCCCAGACACCACAAGATACCAACAGAGCTGAAATAGACAGCCACAGCTTTGGCGAGAAAAACAGCACTCTGTCTGAGGAAGATTATATTGAGAGAAGAAGAGAAGTTGAAAGTATCCTGAAGAAAAACTCAGATTGGATATGGGATTGGTCAAGTCGACCAGAAAATATTCCCCCCAAGGAGTTCCTTTTTAAACACCCGAAGCGCACAGCTACTCTCAGCATGAGAAACACAAGCGTTATGAAGAAAGGGGGAATTTTCTCAGCAGACTTTCTGAAGGTTTTCCTTCCATCTCTGTTACTGTCTCATCTGCTGGCCATTGGCTTGGGGATCTACATTGGAAGGCGTCTGACAACTTCCACTAGCACCTTCTGA |
| ORF Protein Sequence | MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| ORF Viral Vector | vGMAP-SPm-231 | Mouse Bnip3 Adenovirus particle |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.

