Mouse Cd83 ORF/cDNA clone-Lentivirus plasmid (NM_009856.3)

Cat. No.: pGMLV002300
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Cd83/ Lentiviral expression plasmid for Cd83 lentivirus packaging, Cd83 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Purchase
Total Price: $492.53
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002300
Gene Name Cd83
Accession Number NM_009856.3
Gene ID 12522
Species Mouse
Product Type Lentivirus plasmid (overexpression)
Insert Length 591 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGCAAGGCCTCCAGCTCCTGTTTCTAGGCTGCGCCTGCAGCCTGGCACCCGCGATGGCGATGCGGGAGGTGACGGTGGCTTGCTCCGAGACCGCCGACTTGCCTTGCACAGCGCCCTGGGACCCGCAGCTCTCCTATGCAGTGTCCTGGGCCAAGGTCTCCGAGAGTGGCACTGAGAGTGTGGAGCTCCCGGAGAGCAAGCAAAACAGCTCCTTCGAGGCCCCCAGGAGAAGGGCCTATTCCCTGACGATCCAAAACACTACCATCTGCAGCTCGGGCACCTACAGGTGTGCCCTGCAGGAGCTCGGAGGGCAGCGCAACTTGAGCGGCACCGTGGTTCTGAAGGTGACAGGATGCCCCAAGGAAGCTACAGAGTCAACTTTCAGGAAGTACAGGGCAGAAGCTGTGTTGCTCTTCTCTCTGGTTGTTTTCTACCTGACACTCATCATTTTCACCTGCAAATTTGCACGACTACAAAGCATTTTCCCAGATATTTCTAAACCTGGTACGGAACAAGCTTTTCTTCCAGTCACCTCCCCAAGCAAACATTTGGGGCCAGTGACCCTTCCTAAGACAGAAACGGTATGA
ORF Protein Sequence MSQGLQLLFLGCACSLAPAMAMREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMLV002300 Mouse Cd83 Lentivirus particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.