Mouse Lamtor5/1110003H18Rik/Hbxip ORF/cDNA clone-Lentivirus particle (NM_026774)
Cat. No.: vGMLPm003407
Pre-made Mouse Lamtor5/1110003H18Rik/Hbxip Lentiviral expression plasmid for Lamtor5 lentivirus packaging, Lamtor5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLPm003407 | Mouse Lamtor5 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLPm003407 |
| Gene Name | Lamtor5 |
| Accession Number | NM_026774 |
| Gene ID | 68576 |
| Species | Mouse |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 438 bp |
| Gene Alias | 1110003H18Rik,Hbxip,XIP |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCTTTTCGTAAAGAGCGCGGACGCGGCGCCGCGCTGAATTTCGTCCCTCTGGAGACGCCGTCCAGGCGCCCGCCTCGGTCAAGTCACGTGATCGAGGTTTGCGGTGAAGGAGGAAGTGTTTTGCTGCGGGGTCCTGGCCTGGGGCGGACAGCCTGCGGGATGGAGGCGACTTTGGAGCAGCATTTGGAGGACACAATGAAGAATCCATCCATTGTTGGAGTCCTATGCACAGATTCACAAGGACTTAATCTGGGCTGCCGTGGTACCCTGTCGGATGAGCACGCTGGAGTCATATCTGTTCTAGCCCAGCAGGCAGCTAGGCTAACCTCTGACCCCACCGACATCCCTGTGGTATGTTTAGAATCAGATAATGGGAACATTATGATCCAGAAACACGATGGCATCACAGTGGCTGTGCACAAAATGGCCTCTTGA |
| ORF Protein Sequence | MPFRKERGRGAALNFVPLETPSRRPPRSSHVIEVCGEGGSVLLRGPGLGRTACGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAARLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| ORF Viral Vector | pGMLPm003407 | Mouse Lamtor5 Lentivirus plasmid |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.

