Human GDAP1/CMT4/CMT4A ORF/cDNA clone-Adenovirus plasmid (NM_001040875.2)

Cat. No.: pGMAP-SPh-236
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GDAP1/CMT4/CMT4A adenoviral expression plasmid for GDAP1 adenovirus packaging, GDAP1 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to GDAP1/CMT4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-SPh-236
Gene Name GDAP1
Accession Number NM_001040875.2
Gene ID 54332
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 873 bp
Gene Alias CMT4,CMT4A,CMTRIA
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCGTTTGAACTCAACTGGAGAAGTGCCTGTCCTTATCCACGGGGAAAACATAATTTGTGAGGCCACTCAGATCATTGATTATCTTGAACAGACTTTCCTGGATGAAAGAACACCCAGGTTAATGCCTGATAAAGAAAGCATGTATTACCCACGGGTACAACATTACCGAGAGCTGCTTGACTCCTTGCCAATGGATGCCTATACACATGGCTGCATTTTACATCCTGAGTTAACTGTGGACTCCATGATCCCGGCTTATGCAACTACAAGGATTCGTAGCCAAATTGGAAACACAGAGTCTGAGCTGAAGAAACTTGCTGAAGAAAACCCAGATTTACAAGAAGCATACATTGCAAAACAGAAACGACTTAAATCAAAGCTGCTTGATCATGACAATGTCAAGTATTTGAAGAAAATTCTTGATGAGTTGGAGAAAGTCTTGGATCAGGTTGAAACTGAATTGCAAAGAAGAAATGAAGAAACCCCAGAAGAGGGCCAGCAACCTTGGCTCTGCGGTGAATCCTTCACCCTGGCAGACGTCTCACTCGCTGTCACATTGCATCGACTGAAGTTCCTGGGGTTTGCAAGGAGAAACTGGGGAAACGGAAAGCGACCAAACTTGGAAACCTATTACGAGCGTGTCTTGAAGAGAAAAACATTTAACAAGGTTTTAGGACATGTCAACAATATATTAATCTCTGCAGTGCTGCCAACAGCATTCCGGGTGGCCAAGAAAAGGGCCCCAAAAGTTCTTGGCACGACCCTTGTGGTTGGTTTGCTTGCAGGAGTGGGATATTTTGCTTTTATGCTTTTCAGAAAGAGGCTTGGCAGCATGATATTAGCATTTAGACCCAGACCAAATTATTTCTAG
ORF Protein Sequence MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0895-Ab Anti-GDAP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0895-Ag GDAP1 protein
    ORF Viral Vector pGMLP-SPh-096 Human GDAP1 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-236 Human GDAP1 Adenovirus plasmid
    ORF Viral Vector vGMLP-SPh-096 Human GDAP1 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-236 Human GDAP1 Adenovirus particle


    Target information

    Target ID GM-IP0895
    Target Name GDAP1
    Gene ID 54332, 14545, 697136, 312890, 101101612, 487002, 613472, 100050935
    Gene Symbol and Synonyms CMT4,CMT4A,CMTRIA,GDAP1
    Uniprot Accession Q8TB36
    Uniprot Entry Name GDAP1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000104381
    Target Classification Not Available

    This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms and a noncoding variant have been identified for this gene. [provided by RefSeq, Feb 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.