Human CCK ORF/cDNA clone-Adenovirus plasmid (BC008283)

Cat. No.: pGMAP000203
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCK/ adenoviral expression plasmid for CCK adenovirus packaging, CCK adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCK/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000203
Gene Name CCK
Accession Number BC008283
Gene ID 885
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 348 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAACAGCGGCGTGTGCCTGTGCGTGCTGATGGCGGTACTGGCGGCTGGCGCCCTGACGCAGCCGGTGCCTCCCGCAGATCCCGCGGGCTCCGGGCTGCAGCGGGCAGAGGAGGCGCCCCGTAGGCAGCTGAGGGTATCGCAGAGAACGGATGGCGAGTCCCGAGCGCACCTGGGCGCCCTGCTGGCAAGATACATCCAGCAGGCCCGGAAAGCTCCTTCTGGACGAATGTCCATCGTTAAGAACCTGCAGAACCTGGACCCCAGCCACAGGATAAGTGACCGGGACTACATGGGCTGGATGGATTTTGGCCGTCGCAGTGCCGAGGAGTATGAGTACCCCTCCTAG
ORF Protein Sequence MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T24089-Ab Anti-CCKN/ CCK functional antibody
    Target Antigen GM-Tg-g-T24089-Ag CCK protein
    ORF Viral Vector pGMLP000525 Human CCK Lentivirus plasmid
    ORF Viral Vector pGMAP000203 Human CCK Adenovirus plasmid
    ORF Viral Vector vGMLP000525 Human CCK Lentivirus particle
    ORF Viral Vector vGMAP000203 Human CCK Adenovirus particle


    Target information

    Target ID GM-T24089
    Target Name CCK
    Gene ID 885, 12424, 100430777, 25298, 101096837, 609547, 617510, 100055193
    Gene Symbol and Synonyms CCK
    Uniprot Accession P06307
    Uniprot Entry Name CCKN_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000187094
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.