Human CCK ORF/cDNA clone-Adenovirus plasmid (BC008283)
Cat. No.: pGMAP000203
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CCK/ adenoviral expression plasmid for CCK adenovirus packaging, CCK adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
CCK/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000203 |
| Gene Name | CCK |
| Accession Number | BC008283 |
| Gene ID | 885 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 348 bp |
| Gene Alias | |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGAACAGCGGCGTGTGCCTGTGCGTGCTGATGGCGGTACTGGCGGCTGGCGCCCTGACGCAGCCGGTGCCTCCCGCAGATCCCGCGGGCTCCGGGCTGCAGCGGGCAGAGGAGGCGCCCCGTAGGCAGCTGAGGGTATCGCAGAGAACGGATGGCGAGTCCCGAGCGCACCTGGGCGCCCTGCTGGCAAGATACATCCAGCAGGCCCGGAAAGCTCCTTCTGGACGAATGTCCATCGTTAAGAACCTGCAGAACCTGGACCCCAGCCACAGGATAAGTGACCGGGACTACATGGGCTGGATGGATTTTGGCCGTCGCAGTGCCGAGGAGTATGAGTACCCCTCCTAG |
| ORF Protein Sequence | MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T24089-Ab | Anti-CCKN/ CCK functional antibody |
| Target Antigen | GM-Tg-g-T24089-Ag | CCK protein |
| ORF Viral Vector | pGMLP000525 | Human CCK Lentivirus plasmid |
| ORF Viral Vector | pGMAP000203 | Human CCK Adenovirus plasmid |
| ORF Viral Vector | vGMLP000525 | Human CCK Lentivirus particle |
| ORF Viral Vector | vGMAP000203 | Human CCK Adenovirus particle |
Target information
| Target ID | GM-T24089 |
| Target Name | CCK |
| Gene ID | 885, 12424, 100430777, 25298, 101096837, 609547, 617510, 100055193 |
| Gene Symbol and Synonyms | CCK |
| Uniprot Accession | P06307 |
| Uniprot Entry Name | CCKN_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000187094 |
| Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


