Human IL15/IL-15/MGC9721 ORF/cDNA clone-Adenovirus plasmid (BC018149)

Cat. No.: pGMAP000344
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL15/IL-15/MGC9721 adenoviral expression plasmid for IL15 adenovirus packaging, IL15 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL15/IL-15 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000344
Gene Name IL15
Accession Number BC018149
Gene ID 3600
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 489 bp
Gene Alias IL-15,MGC9721
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAATTTCGAAACCACATTTGAGAAGTATTTCCATCCAGTGCTACTTGTGTTTACTTCTAAACAGTCATTTTCTAACTGAAGCTGGCATTCATGTCTTCATTTTGGGCTGTTTCAGTGCAGGGCTTCCTAAAACAGAAGCCAACTGGGTGAATGTAATAAGTGATTTGAAAAAAATTGAAGATCTTATTCAATCTATGCATATTGATGCTACTTTATATACGGAAAGTGATGTTCACCCCAGTTGCAAAGTAACAGCAATGAAGTGCTTTCTCTTGGAGTTACAAGTTATTTCACTTGAGTCCGGAGATGCAAGTATTCATGATACAGTAGAAAATCTGATCATCCTAGCAAACAACAGTTTGTCTTCTAATGGGAATGTAACAGAATCTGGATGCAAAGAATGTGAGGAACTGGAGGAAAAAAATATTAAAGAATTTTTGCAGAGTTTTGTACATATTGTCCAAATGTTCATCAACACTTCTTGA
ORF Protein Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-864 Pre-Made Inbakicept biosimilar, Fusion Protein: Recombinant therapeutic protein targeting IL15 fused with human IGHG1 Fc (Fragment constant)
    Biosimilar GMP-Bios-ab-410 Pre-Made Ordesekimab biosimilar, Whole Mab: Anti-IL15 therapeutic antibody
    Target Antibody GM-Tg-g-T32240-Ab Anti-IL15/ IL-15 functional antibody
    Target Antigen GM-Tg-g-T32240-Ag IL15 protein
    ORF Viral Vector pGMLP000483 Human IL15 Lentivirus plasmid
    ORF Viral Vector pGMLV001105 Human IL15 Lentivirus plasmid
    ORF Viral Vector pGMAP000344 Human IL15 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-018 Human IL15 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-101 Human IL15 Adenovirus plasmid
    ORF Viral Vector vGMLP000483 Human IL15 Lentivirus particle
    ORF Viral Vector vGMLV001105 Human IL15 Lentivirus particle
    ORF Viral Vector vGMAP000344 Human IL15 Adenovirus particle
    ORF Viral Vector vGMLP-IL-018 Human IL15 Lentivirus particle
    ORF Viral Vector vGMAP-IL-101 Human IL15 Adenovirus particle


    Target information

    Target ID GM-T32240
    Target Name IL15
    Gene ID 3600, 16168, 699616, 25670, 493682, 403584, 281248, 100034058
    Gene Symbol and Synonyms IL-15,IL15
    Uniprot Accession P40933
    Uniprot Entry Name IL15_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease Cancer
    Gene Ensembl ENSG00000164136
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)

    The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported. [provided by RefSeq, Feb 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.