Human IL25/IL-17E/IL-25 ORF/cDNA clone-Adenovirus plasmid (BC069565)
Cat. No.: pGMAP000371
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL25/IL-17E/IL-25 adenoviral expression plasmid for IL25 adenovirus packaging, IL25 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
IL25/IL-17E products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000371 |
| Gene Name | IL25 |
| Accession Number | BC069565 |
| Gene ID | 64806 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 534 bp |
| Gene Alias | IL-17E,IL-25 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGGGAGCGACCCAGATTAGGTGAGGACAGTTCTCTCATTAGCCTTTTCCTACAGGTGGTTGCATTCTTGGCAATGGTCATGGGAACCCACACCTACAGCCACTGGCCCAGCTGCTGCCCCAGCAAAGGGCAGGACACCTCTGAGGAGCTGCTGAGGTGGAGCACTGTGCCTGTGCCTCCCCTAGAGCCTGCTAGGCCCAACCGCCACCCAGAGTCCTGTAGGGCCAGTGAAGATGGACCCCTCAACAGCAGGGCCATCTCCCCCTGGAGATATGAGTTGGACAGAGACTTGAACCGGCTCCCCCAGGACCTGTACCACGCCCGTTGCCTGTGCCCGCACTGCGTCAGCCTACAGACAGGCTCCCACATGGACCCCCGGGGCAACTCGGAGCTGCTCTACCACAACCAGACTGTCTTCTACAGGCGGCCATGCCATGGCGAGAAGGGCACCCACAAGGGCTACTGCCTGGAGCGCAGGCTGTACCGTGTTTCCTTAGCTTGTGTGTGTGTGCGGCCCCGTGTGATGGGCTAG |
| ORF Protein Sequence | MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T62241-Ab | Anti-IL25/ IL17E functional antibody |
| Target Antigen | GM-Tg-g-T62241-Ag | IL25 protein |
| Cytokine | cks-Tg-g-GM-T62241 | Interleukin 25 (IL25) protein & antibody |
| ORF Viral Vector | pGMAP000371 | Human IL25 Adenovirus plasmid |
| ORF Viral Vector | pGMLP-IL-032 | Human IL25 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-115 | Human IL25 Adenovirus plasmid |
| ORF Viral Vector | vGMAP000371 | Human IL25 Adenovirus particle |
| ORF Viral Vector | vGMLP-IL-032 | Human IL25 Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-115 | Human IL25 Adenovirus particle |
Target information
| Target ID | GM-T62241 |
| Target Name | IL25 |
| Gene ID | 64806, 140806, 713943, 501996, 101095746, 480252, 526816, 111768801 |
| Gene Symbol and Synonyms | IL-17e,IL-25,IL17E,IL25,RGD1561632 |
| Uniprot Accession | Q9H293 |
| Uniprot Entry Name | IL25_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000166090 |
| Target Classification | Not Available |
The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


