Human HILPDA/C7orf68/HIG-2 ORF/cDNA clone-Lentivirus plasmid (NM_013332)
Cat. No.: pGMLV001019
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HILPDA/C7orf68/HIG-2 Lentiviral expression plasmid for HILPDA lentivirus packaging, HILPDA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HILPDA/C7orf68 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001019 |
| Gene Name | HILPDA |
| Accession Number | NM_013332 |
| Gene ID | 29923 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 192 bp |
| Gene Alias | C7orf68,HIG-2,HIG2 |
| Fluorescent Reporter | mCherry |
| Mammalian Cell Selection | Neomycin |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAGCATGTGTTGAACCTCTACCTGTTAGGTGTGGTACTGACCCTACTCTCCATCTTCGTTAGAGTGATGGAGTCCCTAGAGGGCTTACTAGAGAGCCCATCGCCTGGGACCTCCTGGACCACCAGAAGCCAACTAGCCAACACAGAGCCCACCAAGGGCCTTCCAGACCATCCATCCAGAAGCATGTGA |
| ORF Protein Sequence | MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0263-Ab | Anti-HLPDA/ HILPDA/ C7orf68 functional antibody |
| Target Antigen | GM-Tg-g-SE0263-Ag | HILPDA protein |
| ORF Viral Vector | pGMLP002520 | Human HILPDA Lentivirus plasmid |
| ORF Viral Vector | pGMLV001019 | Human HILPDA Lentivirus plasmid |
| ORF Viral Vector | pGMPC001499 | Human HILPDA Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP002520 | Human HILPDA Lentivirus particle |
| ORF Viral Vector | vGMLV001019 | Human HILPDA Lentivirus particle |
Target information
| Target ID | GM-SE0263 |
| Target Name | HILPDA |
| Gene ID | 29923, 69573, 701261, 100361568, 101084528, 100688487, 100125928, 102150776 |
| Gene Symbol and Synonyms | 2310016C08Rik,C3H7orf68,C4H7orf68,C7orf68,HIG-2,HIG2,HILPDA |
| Uniprot Accession | Q9Y5L2 |
| Uniprot Entry Name | HLPDA_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000135245 |
| Target Classification | Not Available |
Enables signaling receptor binding activity. Involved in several processes, including autocrine signaling; cellular response to hypoxia; and positive regulation of lipid storage. Located in several cellular components, including cell surface; lipid droplet; and secretory granule. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


