Human DNASE1L3/DHP2/DNAS1L3 ORF/cDNA clone-Lentivirus plasmid (NM_004944.4)
Cat. No.: pGMLV001380
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human DNASE1L3/DHP2/DNAS1L3 Lentiviral expression plasmid for DNASE1L3 lentivirus packaging, DNASE1L3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
DNASE1L3/DHP2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001380 |
| Gene Name | DNASE1L3 |
| Accession Number | NM_004944.4 |
| Gene ID | 1776 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 918 bp |
| Gene Alias | DHP2,DNAS1L3,LSD,SLEB16 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCACGGGAGCTGGCCCCACTGCTGCTTCTCCTCCTCTCCATCCACAGCGCCCTGGCCATGAGGATCTGCTCCTTCAACGTCAGGTCCTTTGGGGAAAGCAAGCAGGAAGACAAGAATGCCATGGATGTCATTGTGAAGGTCATCAAACGCTGTGACATCATACTCGTGATGGAAATCAAGGACAGCAACAACAGGATCTGCCCCATACTGATGGAGAAGCTGAACAGAAATTCAAGGAGAGGCATAACGTACAACTATGTGATTAGCTCTCGGCTTGGAAGAAACACATATAAAGAACAATATGCCTTTCTCTACAAGGAAAAGCTGGTGTCTGTGAAGAGGAGTTATCACTACCATGACTATCAGGATGGAGACGCAGATGTGTTTTCCAGGGAGCCCTTTGTGGTCTGGTTCCAATCTCCCCACACTGCTGTCAAAGACTTCGTGATTATCCCCCTGCACACCACCCCAGAGACATCCGTTAAGGAGATCGATGAGTTGGTTGAGGTCTACACGGACGTGAAACACCGCTGGAAGGCGGAGAATTTCATTTTCATGGGTGACTTCAATGCCGGCTGCAGCTACGTCCCCAAGAAGGCCTGGAAGAACATCCGCTTGAGGACTGACCCCAGGTTTGTTTGGCTGATCGGGGACCAAGAGGACACCACGGTGAAGAAGAGCACCAACTGTGCATATGACAGGATTGTGCTTAGAGGACAAGAAATCGTCAGTTCTGTTGTTCCCAAGTCAAACAGTGTTTTTGACTTCCAGAAAGCTTACAAGCTGACTGAAGAGGAGGCCCTGGATGTCAGCGACCACTTTCCAGTTGAATTTAAACTACAGTCTTCAAGGGCCTTCACCAACAGCAAAAAATCTGTCACTCTAAGGAAGAAAACAAAGAGCAAACGCTCCTAG |
| ORF Protein Sequence | MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0893-Ab | Anti-DNSL3/ DNASE1L3/ DHP2 functional antibody |
| Target Antigen | GM-Tg-g-SE0893-Ag | DNASE1L3 protein |
| ORF Viral Vector | pGMLP002363 | Human DNASE1L3 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001380 | Human DNASE1L3 Lentivirus plasmid |
| ORF Viral Vector | pGMPC001849 | Human DNASE1L3 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP002363 | Human DNASE1L3 Lentivirus particle |
| ORF Viral Vector | vGMLV001380 | Human DNASE1L3 Lentivirus particle |
Target information
| Target ID | GM-SE0893 |
| Target Name | DNASE1L3 |
| Gene ID | 1776, 13421, 702613, 116687, 101099361, 476576, 512512, 100057863 |
| Gene Symbol and Synonyms | DHP2,DNAS1L3,DNASE1L3,DNasegamma,LSD,SLEB16 |
| Uniprot Accession | Q13609 |
| Uniprot Entry Name | DNSL3_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000163687 |
| Target Classification | Not Available |
This gene encodes a member of the deoxyribonuclease I family. The encoded protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Mutations in this gene are a cause of systemic lupus erythematosus-16. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


