Human CLN5 ORF/cDNA clone-Lentivirus plasmid (NM_006493.4)

Cat. No.: pGMLV001663
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLN5/ Lentiviral expression plasmid for CLN5 lentivirus packaging, CLN5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CLN5/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $601.56
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001663
Gene Name CLN5
Accession Number NM_006493.4
Gene ID 1203
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1077 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Neomycin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCAGGAGGTAGACACGGCACAGGGCGCCGAGATGCGGCGGGGCGCGGGCGCGGCTCGGGGACGCGCTTCCTGGTGCTGGGCCCTGGCGCTGCTTTGGCTCGCGGTGGTTCCGGGCTGGTCCCGGGTCTCGGGCATCCCCTCCCGGCGCCACTGGCCGGTGCCCTACAAGCGCTTTGACTTCCGTCCAAAACCTGATCCTTATTGTCAAGCTAAGTATACTTTCTGTCCAACTGGCTCACCTATCCCAGTTATGGAGGGTGATGATGACATTGAAGTTTTTCGATTACAAGCCCCAGTATGGGAATTTAAATATGGAGACCTCCTGGGACACTTGAAAATTATGCATGATGCCATTGGATTCAGAAGTACATTAACTGGCAAGAACTACACAATGGAATGGTATGAACTTTTCCAACTTGGCAACTGTACATTTCCCCATCTCCGACCTGAAATGGATGCCCCTTTCTGGTGTAATCAAGGCGCTGCCTGCTTTTTTGAGGGAATTGATGATGTTCACTGGAAGGAAAATGGGACATTAGTTCAAGTAGCAACTATATCAGGAAACATGTTCAACCAAATGGCAAAGTGGGTGAAACAGGACAATGAAACAGGAATTTATTATGAGACATGGAATGTAAAAGCCAGCCCAGAAAAGGGGGCAGAGACATGGTTTGATTCCTACGACTGTTCCAAATTTGTGTTAAGGACCTTTAACAAGTTGGCTGAATTTGGAGCAGAGTTCAAGAACATAGAAACCAACTATACAAGAATATTTCTTTACAGTGGAGAACCTACTTATCTGGGAAATGAAACATCTGTTTTTGGGCCAACAGGAAACAAGACTCTTGGTTTAGCCATAAAAAGATTTTATTACCCCTTCAAACCACATTTGCCAACTAAAGAATTTCTGTTGAGTCTCTTGCAAATTTTTGATGCAGTGATTGTGCACAAACAGTTCTATTTGTTTTATAATTTTGAATATTGGTTTTTACCTATGAAATTCCCTTTTATTAAAATAACATATGAAGAAATCCCTTTACCTATCAGAAACAAAACACTCTCTGGTTTATAA
ORF Protein Sequence MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0094-Ab Anti-CLN5 functional antibody
    Target Antigen GM-Tg-g-SE0094-Ag CLN5 protein
    ORF Viral Vector pGMLP001766 Human CLN5 Lentivirus plasmid
    ORF Viral Vector pGMLV001663 Human CLN5 Lentivirus plasmid
    ORF Viral Vector vGMLP001766 Human CLN5 Lentivirus particle
    ORF Viral Vector vGMLV001663 Human CLN5 Lentivirus particle


    Target information

    Target ID GM-SE0094
    Target Name CLN5
    Gene ID 1203, 211286, 696352, 306128, 101085427, 485498, 529186, 100052699
    Gene Symbol and Synonyms A730075N08Rik,CLN5
    Uniprot Accession O75503
    Uniprot Entry Name CLN5_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000102805
    Target Classification Not Available

    This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.[provided by RefSeq, Oct 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.