Human CLN5 ORF/cDNA clone-Lentivirus plasmid (NM_006493.4)
Cat. No.: pGMLV001663
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CLN5/ Lentiviral expression plasmid for CLN5 lentivirus packaging, CLN5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CLN5/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001663 |
| Gene Name | CLN5 |
| Accession Number | NM_006493.4 |
| Gene ID | 1203 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 1077 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Neomycin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGCAGGAGGTAGACACGGCACAGGGCGCCGAGATGCGGCGGGGCGCGGGCGCGGCTCGGGGACGCGCTTCCTGGTGCTGGGCCCTGGCGCTGCTTTGGCTCGCGGTGGTTCCGGGCTGGTCCCGGGTCTCGGGCATCCCCTCCCGGCGCCACTGGCCGGTGCCCTACAAGCGCTTTGACTTCCGTCCAAAACCTGATCCTTATTGTCAAGCTAAGTATACTTTCTGTCCAACTGGCTCACCTATCCCAGTTATGGAGGGTGATGATGACATTGAAGTTTTTCGATTACAAGCCCCAGTATGGGAATTTAAATATGGAGACCTCCTGGGACACTTGAAAATTATGCATGATGCCATTGGATTCAGAAGTACATTAACTGGCAAGAACTACACAATGGAATGGTATGAACTTTTCCAACTTGGCAACTGTACATTTCCCCATCTCCGACCTGAAATGGATGCCCCTTTCTGGTGTAATCAAGGCGCTGCCTGCTTTTTTGAGGGAATTGATGATGTTCACTGGAAGGAAAATGGGACATTAGTTCAAGTAGCAACTATATCAGGAAACATGTTCAACCAAATGGCAAAGTGGGTGAAACAGGACAATGAAACAGGAATTTATTATGAGACATGGAATGTAAAAGCCAGCCCAGAAAAGGGGGCAGAGACATGGTTTGATTCCTACGACTGTTCCAAATTTGTGTTAAGGACCTTTAACAAGTTGGCTGAATTTGGAGCAGAGTTCAAGAACATAGAAACCAACTATACAAGAATATTTCTTTACAGTGGAGAACCTACTTATCTGGGAAATGAAACATCTGTTTTTGGGCCAACAGGAAACAAGACTCTTGGTTTAGCCATAAAAAGATTTTATTACCCCTTCAAACCACATTTGCCAACTAAAGAATTTCTGTTGAGTCTCTTGCAAATTTTTGATGCAGTGATTGTGCACAAACAGTTCTATTTGTTTTATAATTTTGAATATTGGTTTTTACCTATGAAATTCCCTTTTATTAAAATAACATATGAAGAAATCCCTTTACCTATCAGAAACAAAACACTCTCTGGTTTATAA |
| ORF Protein Sequence | MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0094-Ab | Anti-CLN5 functional antibody |
| Target Antigen | GM-Tg-g-SE0094-Ag | CLN5 protein |
| ORF Viral Vector | pGMLP001766 | Human CLN5 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001663 | Human CLN5 Lentivirus plasmid |
| ORF Viral Vector | vGMLP001766 | Human CLN5 Lentivirus particle |
| ORF Viral Vector | vGMLV001663 | Human CLN5 Lentivirus particle |
Target information
| Target ID | GM-SE0094 |
| Target Name | CLN5 |
| Gene ID | 1203, 211286, 696352, 306128, 101085427, 485498, 529186, 100052699 |
| Gene Symbol and Synonyms | A730075N08Rik,CLN5 |
| Uniprot Accession | O75503 |
| Uniprot Entry Name | CLN5_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000102805 |
| Target Classification | Not Available |
This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.[provided by RefSeq, Oct 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


