Human IGFBP7/AGM/FSTL2 ORF/cDNA clone-Lentivirus plasmid (NM_001553)
Cat. No.: pGMLV001817
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IGFBP7/AGM/FSTL2 Lentiviral expression plasmid for IGFBP7 lentivirus packaging, IGFBP7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IGFBP7/AGM products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001817 |
| Gene Name | IGFBP7 |
| Accession Number | NM_001553 |
| Gene ID | 3490 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 849 bp |
| Gene Alias | AGM,FSTL2,IBP-7,IGFBP-7,IGFBP-7v,IGFBPRP1,MAC25,PSF,RAMSVPS,TAF |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAGCGGCCGTCGCTGCGCGCCCTGCTCCTCGGCGCCGCTGGGCTGCTGCTCCTGCTCCTGCCCCTCTCCTCTTCCTCCTCTTCGGACACCTGCGGCCCCTGCGAGCCGGCCTCCTGCCCGCCCCTGCCCCCGCTGGGCTGCCTGCTGGGCGAGACCCGCGACGCGTGCGGCTGCTGCCCTATGTGCGCCCGCGGCGAGGGCGAGCCGTGCGGGGGTGGCGGCGCCGGCAGGGGGTACTGCGCGCCGGGCATGGAGTGCGTGAAGAGCCGCAAGAGGCGGAAGGGTAAAGCCGGGGCAGCAGCCGGCGGTCCGGGTGTAAGCGGCGTGTGCGTGTGCAAGAGCCGCTACCCGGTGTGCGGCAGCGACGGCACCACCTACCCGAGCGGCTGCCAGCTGCGCGCCGCCAGCCAGAGGGCCGAGAGCCGCGGGGAGAAGGCCATCACCCAGGTCAGCAAGGGCACCTGCGAGCAAGGTCCTTCCATAGTGACGCCCCCCAAGGACATCTGGAATGTCACTGGTGCCCAGGTGTACTTGAGCTGTGAGGTCATCGGAATCCCGACACCTGTCCTCATCTGGAACAAGGTAAAAAGGGGTCACTATGGAGTTCAAAGGACAGAACTCCTGCCTGGTGACCGGGACAACCTGGCCATTCAGACCCGGGGTGGCCCAGAAAAGCATGAAGTAACTGGCTGGGTGCTGGTATCTCCTCTAAGTAAGGAAGATGCTGGAGAATATGAGTGCCATGCATCCAATTCCCAAGGACAGGCTTCAGCATCAGCAAAAATTACAGTGGTTGATGCCTTACATGAAATACCAGTGAAAAAAGGTGAAGGTGCCGAGCTATAA |
| ORF Protein Sequence | MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T69271-Ab | Anti-IBP7/ IGFBP7/ AGM functional antibody |
| Target Antigen | GM-Tg-g-T69271-Ag | IGFBP7 protein |
| Cytokine | cks-Tg-g-GM-T69271 | insulin-like growth factor binding protein 7 (IGFBP7) protein & antibody |
| ORF Viral Vector | pGMLP003505 | Human IGFBP7 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001817 | Human IGFBP7 Lentivirus plasmid |
| ORF Viral Vector | pGMPC001481 | Human IGFBP7 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP003505 | Human IGFBP7 Lentivirus particle |
| ORF Viral Vector | vGMLV001817 | Human IGFBP7 Lentivirus particle |
Target information
| Target ID | GM-T69271 |
| Target Name | IGFBP7 |
| Gene ID | 3490, 29817, 693564, 289560, 101083263, 608559, 616368, 100033844 |
| Gene Symbol and Synonyms | AGM,FSTL2,IBP-7,IGFBP-7,IGFBP-7v,IGFBP7,IGFBPRP1,MAC25,PSF,RAMSVPS,TAF |
| Uniprot Accession | Q16270 |
| Uniprot Entry Name | IBP7_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | Dent disease, Heart failure, Acute kidney failure |
| Gene Ensembl | ENSG00000163453 |
| Target Classification | Not Available |
This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm (PMID:21835307). [provided by RefSeq, Dec 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


