Human GRINA/HNRGW/LFG1 ORF/cDNA clone-Lentivirus plasmid (NM_000837)

Cat. No.: pGMLV001936
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GRINA/HNRGW/LFG1 Lentiviral expression plasmid for GRINA lentivirus packaging, GRINA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GRINA/HNRGW products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $612.48
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001936
Gene Name GRINA
Accession Number NM_000837
Gene ID 2907
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1116 bp
Gene Alias HNRGW,LFG1,NMDARA1,TMBIM3
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCCATGAAAAGAGTTTTTTGGTGTCTGGGGACAACTATCCTCCCCCCAACCCTGGATATCCGGGGGGGCCCCAGCCACCCATGCCCCCCTATGCTCAGCCTCCCTACCCTGGGGCCCCTTACCCACAGCCCCCTTTCCAGCCCTCCCCCTACGGTCAGCCAGGGTACCCCCATGGCCCCAGCCCCTACCCCCAAGGGGGCTACCCACAGGGTCCCTACCCCCAAGGGGGCTACCCACAGGGCCCCTACCCACAAGAGGGCTACCCACAGGGCCCCTACCCCCAAGGGGGCTACCCCCAGGGGCCATATCCCCAGAGCCCCTTCCCCCCCAACCCCTATGGACAGCCACAGGTCTTCCCAGGACAAGACCCTGACTCACCCCAGCATGGAAACTACCAGGAGGAGGGTCCCCCATCCTACTATGACAACCAGGACTTCCCTGCCACCAACTGGGATGACAAGAGCATCCGACAGGCCTTCATCCGCAAGGTGTTCCTAGTGCTGACCTTGCAGCTGTCGGTGACCCTGTCCACGGTGTCTGTGTTCACTTTTGTTGCGGAGGTGAAGGGCTTTGTCCGGGAGAATGTCTGGACCTACTATGTCTCCTATGCTGTCTTCTTCATCTCTCTCATCGTCCTCAGCTGTTGTGGGGACTTCCGGCGAAAGCACCCCTGGAACCTTGTTGCACTGTCGGTCCTGACCGCCAGCCTGTCGTACATGGTGGGGATGATCGCCAGCTTCTACAACACCGAGGCAGTCATCATGGCCGTGGGCATCACCACAGCCGTCTGCTTCACCGTCGTCATCTTCTCCATGCAGACCCGCTACGACTTCACCTCATGCATGGGCGTGCTCCTGGTGAGCATGGTGGTGCTCTTCATCTTCGCCATTCTCTGCATCTTCATCCGGAACCGCATCCTGGAGATCGTGTACGCCTCACTGGGCGCTCTGCTCTTCACCTGCTTCCTCGCAGTGGACACCCAGCTGCTACTGGGGAACAAGCAGCTGTCCCTGAGCCCAGAAGAGTATGTGTTTGCTGCGCTGAACCTGTACACAGACATCATCAACATCTTCCTGTACATCCTCACCATCATTGGCCGCGCCAAGGAGTAG
ORF Protein Sequence MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIVLSCCGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0948-Ab Anti-GRINA monoclonal antibody
    Target Antigen GM-Tg-g-IP0948-Ag GRINA protein
    ORF Viral Vector pGMLP001520 Human GRINA Lentivirus plasmid
    ORF Viral Vector pGMLV001936 Human GRINA Lentivirus plasmid
    ORF Viral Vector vGMLP001520 Human GRINA Lentivirus particle
    ORF Viral Vector vGMLV001936 Human GRINA Lentivirus particle


    Target information

    Target ID GM-IP0948
    Target Name GRINA
    Gene ID 2907, 66168, 266668, 101093245, 475118, 510225, 100065426
    Gene Symbol and Synonyms 1110025J15Rik,GRINA,HNRGW,Lag,LFG1,NMDARA1,TMBIM3
    Uniprot Accession Q7Z429
    Uniprot Entry Name LFG1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000178719
    Target Classification Not Available

    Predicted to enable transmembrane transporter binding activity. Predicted to act upstream of or within endoplasmic reticulum calcium ion homeostasis and negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway. Predicted to be located in Golgi apparatus and endoplasmic reticulum. Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.