Human FAM3C/GS3786/ILEI ORF/cDNA clone-Lentivirus plasmid (NM_001040020.2)
Cat. No.: pGMLV002024
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FAM3C/GS3786/ILEI Lentiviral expression plasmid for FAM3C lentivirus packaging, FAM3C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FAM3C/GS3786 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV002024 |
Gene Name | FAM3C |
Accession Number | NM_001040020.2 |
Gene ID | 10447 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 684 bp |
Gene Alias | GS3786,ILEI |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGGGTAGCAGGTGCTGCAAAGTTGGTGGTAGCTGTGGCAGTGTTTTTACTGACATTTTATGTTATTTCTCAAGTATTTGAAATAAAAATGGATGCAAGTTTAGGAAATCTATTTGCAAGATCAGCATTGGACACAGCTGCACGTTCTACAAAGCCTCCCAGATATAAGTGTGGGATCTCAAAAGCTTGCCCTGAGAAGCATTTTGCTTTTAAAATGGCAAGTGGAGCAGCCAACGTGGTGGGACCCAAAATCTGCCTGGAAGATAATGTTTTAATGAGTGGTGTTAAGAATAATGTTGGAAGAGGGATCAATGTTGCCTTGGCAAATGGAAAAACAGGAGAAGTATTAGACACTAAATATTTTGACATGTGGGGAGGAGATGTGGCACCATTTATTGAGTTTCTGAAGGCCATACAAGATGGAACAATAGTTTTAATGGGAACATACGATGATGGAGCAACCAAACTCAATGATGAGGCACGGCGGCTCATTGCTGATTTGGGGAGCACATCTATTACTAATCTTGGTTTTAGAGACAACTGGGTCTTCTGTGGTGGGAAGGGCATTAAGACAAAAAGCCCTTTTGAACAGCACATAAAGAACAATAAGGATACAAACAAATATGAAGGATGGCCTGAAGTTGTAGAAATGGAAGGATGCATCCCCCAGAAGCAAGACTAA |
ORF Protein Sequence | MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0205-Ab | Anti-FAM3C/ GS3786/ ILEI functional antibody |
Target Antigen | GM-Tg-g-SE0205-Ag | FAM3C protein |
ORF Viral Vector | pGMLP005152 | Human FAM3C Lentivirus plasmid |
ORF Viral Vector | pGMLV002024 | Human FAM3C Lentivirus plasmid |
ORF Viral Vector | pGMAD000777 | Human FAM3C Adenovirus plasmid |
ORF Viral Vector | vGMLP005152 | Human FAM3C Lentivirus particle |
ORF Viral Vector | vGMLV002024 | Human FAM3C Lentivirus particle |
ORF Viral Vector | vGMAD000777 | Human FAM3C Adenovirus particle |
Target information
Target ID | GM-SE0205 |
Target Name | FAM3C |
Gene ID | 10447, 27999, 694209, 312159, 101090506, 612336, 615690, 100071408 |
Gene Symbol and Synonyms | D6Wsu176e,FAM3C,GS3786,ILEI |
Uniprot Accession | Q92520 |
Uniprot Entry Name | FAM3C_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Malignant neoplasm of bladder |
Gene Ensembl | ENSG00000196937 |
Target Classification | Not Available |
This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.