Human PFN1/ALS18 ORF/cDNA clone-Lentivirus plasmid (NM_005022.4)

Cat. No.: pGMLV002114
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PFN1/ALS18 Lentiviral expression plasmid for PFN1 lentivirus packaging, PFN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PFN1/ALS18 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002114
Gene Name PFN1
Accession Number NM_005022.4
Gene ID 5216
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 423 bp
Gene Alias ALS18
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 6xHis (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGGGTGGAACGCCTACATCGACAACCTCATGGCGGACGGGACCTGTCAGGACGCGGCCATCGTGGGCTACAAGGACTCGCCCTCCGTCTGGGCCGCCGTCCCCGGGAAAACGTTCGTCAACATCACGCCAGCTGAGGTGGGTGTCCTGGTTGGCAAAGACCGGTCAAGTTTTTACGTGAATGGGCTGACACTTGGGGGCCAGAAATGTTCGGTGATCCGGGACTCACTGCTGCAGGATGGGGAATTTAGCATGGATCTTCGTACCAAGAGCACCGGTGGGGCCCCCACCTTCAATGTCACTGTCACCAAGACTGACAAGACGCTAGTCCTGCTGATGGGCAAAGAAGGTGTCCACGGTGGTTTGATCAACAAGAAATGTTATGAAATGGCCTCCCACCTTCGGCGTTCCCAGTACTGA
ORF Protein Sequence MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1376-Ab Anti-PFN1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1376-Ag PFN1 protein
    ORF Viral Vector pGMLV002114 Human PFN1 Lentivirus plasmid
    ORF Viral Vector pGMAP000098 Human PFN1 Adenovirus plasmid
    ORF Viral Vector pGMPC001402 Human PFN1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV002114 Human PFN1 Lentivirus particle
    ORF Viral Vector vGMAP000098 Human PFN1 Adenovirus particle


    Target information

    Target ID GM-IP1376
    Target Name PFN1
    Gene ID 5216, 18643, 710753, 64303, 101091824, 607397, 513895, 100061295
    Gene Symbol and Synonyms ALS18,Pfn,PFN1,profilin-1
    Uniprot Accession P07737
    Uniprot Entry Name PROF1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Dent disease, Malignant neoplasm of bladder
    Gene Ensembl ENSG00000108518
    Target Classification Not Available

    This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. [provided by RefSeq, Jul 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.