Human GPX7/CL683/GPx-7 ORF/cDNA clone-Lentivirus plasmid (NM_015696.5)

Cat. No.: pGMLV002116
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GPX7/CL683/GPx-7 Lentiviral expression plasmid for GPX7 lentivirus packaging, GPX7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GPX7/CL683 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $441
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002116
Gene Name GPX7
Accession Number NM_015696.5
Gene ID 2882
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 564 bp
Gene Alias CL683,GPx-7,GPX6,GSHPx-7,NPGPx
Fluorescent Reporter null
Mammalian Cell Selection Neomycin
Fusion Tag HA (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGGCGGCGACGGTGGCAGCGGCGTGGCTGCTCCTGTGGGCTGCGGCCTGCGCGCAGCAGGAGCAGGACTTCTACGACTTCAAGGCGGTCAACATCCGGGGCAAACTGGTGTCGCTGGAGAAGTACCGCGGATCGGTGTCCCTGGTGGTGAATGTGGCCAGCGAGTGCGGCTTCACAGACCAGCACTACCGAGCCCTGCAGCAGCTGCAGCGAGACCTGGGCCCCCACCACTTTAACGTGCTCGCCTTCCCCTGCAACCAGTTTGGCCAACAGGAGCCTGACAGCAACAAGGAGATTGAGAGCTTTGCCCGCCGCACCTACAGTGTCTCATTCCCCATGTTTAGCAAGATTGCAGTCACCGGTACTGGTGCCCATCCTGCCTTCAAGTACCTGGCCCAGACTTCTGGGAAGGAGCCCACCTGGAACTTCTGGAAGTACCTAGTAGCCCCAGATGGAAAGGTGGTAGGGGCTTGGGACCCAACTGTGTCAGTGGAGGAGGTCAGACCCCAGATCACAGCGCTCGTGAGGAAGCTCATCCTACTGAAGCGAGAAGACTTATAA
ORF Protein Sequence MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0958-Ab Anti-GPX7/ CL683/ GPX6 functional antibody
    Target Antigen GM-Tg-g-SE0958-Ag GPX7 protein
    ORF Viral Vector pGMLP000411 Human GPX7 Lentivirus plasmid
    ORF Viral Vector pGMLV002116 Human GPX7 Lentivirus plasmid
    ORF Viral Vector vGMLP000411 Human GPX7 Lentivirus particle
    ORF Viral Vector vGMLV002116 Human GPX7 Lentivirus particle


    Target information

    Target ID GM-SE0958
    Target Name GPX7
    Gene ID 2882, 67305, 715474, 298376, 101091642, 475348, 523311, 100050590
    Gene Symbol and Synonyms 3110050F08Rik,CL683,GPx-7,GPX6,GPX7,GSHPx-7,NPGPx
    Uniprot Accession Q96SL4
    Uniprot Entry Name GPX7_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000116157
    Target Classification Not Available

    Enables catalase activity. Predicted to be involved in cellular response to oxidative stress. Located in endoplasmic reticulum. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.