Human SRD5A3/CDG1P/CDG1Q ORF/cDNA clone-Lentivirus plasmid (NM_024592.5)

Cat. No.: pGMLV002417
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SRD5A3/CDG1P/CDG1Q Lentiviral expression plasmid for SRD5A3 lentivirus packaging, SRD5A3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SRD5A3/CDG1P products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $539.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002417
Gene Name SRD5A3
Accession Number NM_024592.5
Gene ID 79644
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 957 bp
Gene Alias CDG1P,CDG1Q,KRIZI,S5AR,S5AR 3,SRD5A2L,SRD5A2L1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCCCTGGGCGGAGGCCGAGCACTCGGCGCTGAACCCGCTGCGCGCGGTGTGGCTCACGCTGACCGCCGCCTTCCTGCTGACCCTACTGCTGCAGCTCCTGCCGCCCGGCCTGCTCCCGGGCTGCGCGATCTTCCAGGACCTGATCCGCTATGGGAAAACCAAGTGTGGGGAGCCGTCGCGCCCCGCCGCCTGCCGAGCCTTTGATGTCCCCAAGAGATATTTTTCCCACTTTTATATCATCTCAGTGCTGTGGAATGGCTTCCTGCTTTGGTGCCTTACTCAATCTCTGTTCCTGGGAGCACCTTTTCCAAGCTGGCTTCATGGTTTGCTCAGAATTCTCGGGGCGGCACAGTTCCAGGGAGGGGAGCTGGCACTGTCTGCATTCTTAGTGCTAGTATTTCTGTGGCTGCACAGCTTACGAAGACTCTTCGAGTGCCTCTACGTCAGTGTCTTCTCCAATGTCATGATTCACGTCGTGCAGTACTGTTTTGGACTTGTCTATTATGTCCTTGTTGGCCTAACTGTGCTGAGCCAAGTGCCAATGGATGGCAGGAATGCCTACATAACAGGGAAAAATCTATTGATGCAAGCACGGTGGTTCCATATTCTTGGGATGATGATGTTCATCTGGTCATCTGCCCATCAGTATAAGTGCCATGTTATTCTCGGCAATCTCAGGAAAAATAAAGCAGGAGTGGTCATTCACTGTAACCACAGGATCCCATTTGGAGACTGGTTTGAATATGTTTCTTCCCCTAACTACTTAGCAGAGCTGATGATCTACGTTTCCATGGCCGTCACCTTTGGGTTCCACAACTTAACTTGGTGGCTAGTGGTGACAAATGTCTTCTTTAATCAGGCCCTGTCTGCCTTTCTCAGCCACCAATTCTACAAAAGCAAATTTGTCTCTTACCCGAAGCATAGGAAAGCTTTCCTACCATTTTTGTTTTAA
ORF Protein Sequence MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0260-Ab Anti-SRD5A3 monoclonal antibody
    Target Antigen GM-Tg-g-IP0260-Ag SRD5A3 protein
    ORF Viral Vector pGMLV002417 Human SRD5A3 Lentivirus plasmid
    ORF Viral Vector vGMLV002417 Human SRD5A3 Lentivirus particle


    Target information

    Target ID GM-IP0260
    Target Name SRD5A3
    Gene ID 79644, 57357, 696381, 305291, 101090010, 482155, 535834, 100059582
    Gene Symbol and Synonyms 1110025P14Rik,A430076C09,CDG1P,CDG1Q,D730040M03Rik,H5ar,KRIZI,RGD1308828,S5AR,S5AR 3,SRD5A2L,SRD5A2L1,SRD5A3
    Uniprot Accession Q9H8P0
    Uniprot Entry Name PORED_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000128039
    Target Classification Not Available

    The protein encoded by this gene belongs to the steroid 5-alpha reductase family, and polyprenol reductase subfamily. It is involved in the production of androgen 5-alpha-dihydrotestosterone (DHT) from testosterone, and maintenance of the androgen-androgen receptor activation pathway. This protein is also necessary for the conversion of polyprenol into dolichol, which is required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-linked glycosylation of proteins. Mutations in this gene are associated with congenital disorder of glycosylation type Iq. [provided by RefSeq, Mar 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.