Human TAZ/BTHS/CMD3A ORF/cDNA clone-Adenovirus particle (NM_181311.3)

Cat. No.: vGMAP-SPh-162

Pre-made Human TAZ/BTHS/CMD3A Adenovirus for TAZ overexpression in-vitro and in-vivo. The TAZ adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TAZ-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to TAZ/BTHS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-SPh-162 Human TAZ Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-SPh-162
Gene Name TAZ
Accession Number NM_181311.3
Gene ID 6901
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 789 bp
Gene Alias BTHS,CMD3A,EFE,EFE2,G4.5,LVNCX,Taz1
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTCTGCACGTGAAGTGGCCGTTCCCCGCGGTGCCGCCGCTCACCTGGACCCTGGCCAGCAGCGTCGTCATGGGCTTGGTGGGCACCTACAGCTGCTTCTGGACCAAGTACATGAACCACCTGACCGTGCACAACAGGGAGGTGCTGTACGAGCTCATCGAGAAGCGAGGCCCGGCCACGCCCCTCATCACCGTGTCCAATCACCAGTCCTGCATGGACGACCCTCATCTCTGGGGGATCCTGAAACTCCGCCACATCTGGAACCTGAAGTTGATGCGTTGGACCCCTGCAGCTGCAGACATCTGCTTCACCAAGGAGCTACACTCCCACTTCTTCAGCTTGGGCAAGTGTGTGCCTGTGTGCCGAGGAGATGGCGTCTACCAGAAGGGGATGGACTTCATTTTGGAGAAGCTCAACCATGGGGACTGGGTGCATATCTTCCCAGAAGGGAAAGTGAACATGAGTTCCGAATTCCTGCGTTTCAAGTGGGGAATCGGGCGCCTGATTGCTGAGTGTCATCTCAACCCCATCATCCTGCCCCTGTGGCATGTCGGAATGAATGACGTCCTTCCTAACAGTCCGCCCTACTTCCCCCGCTTTGGACAGAAAATCACTGTGCTGATCGGGAAGCCCTTCAGTGCCCTGCCTGTACTCGAGCGGCTCCGGGCGGAGAACAAGTCGGCTGTGGAGATGCGGAAAGCCCTGACGGACTTCATTCAAGAGGAATTCCAGCATCTGAAGACTCAGGCAGAGCAGCTCCACAACCACCTCCAGCCTGGGAGATAG
ORF Protein Sequence MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1886-Ab Anti-TAZ monoclonal antibody
    Target Antigen GM-Tg-g-IP1886-Ag TAZ protein
    ORF Viral Vector pGMLP000972 Human TAZ Lentivirus plasmid
    ORF Viral Vector pGMLV002294 Human TAFAZZIN Lentivirus plasmid
    ORF Viral Vector pGMAD000588 Human TAZ Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-022 Human TAZ Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-162 Human TAZ Adenovirus plasmid
    ORF Viral Vector vGMLP000972 Human TAZ Lentivirus particle
    ORF Viral Vector vGMLV002294 Human TAFAZZIN Lentivirus particle
    ORF Viral Vector vGMAD000588 Human TAZ Adenovirus particle
    ORF Viral Vector vGMLP-SPh-022 Human TAZ Lentivirus particle
    ORF Viral Vector vGMAP-SPh-162 Human TAZ Adenovirus particle


    Target information

    Target ID GM-IP1886
    Target Name TAZ
    Gene ID 6901, 66826, 574297, 363521, 101084092, 119868552, 515177, 100058306
    Gene Symbol and Synonyms 5031411C02Rik,9130012G04Rik,BTHS,CMD3A,EFE,EFE2,G4.5,LVNCX,TAFAZZIN,TAZ,Taz1
    Uniprot Accession Q16635
    Uniprot Entry Name TAZ_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000102125
    Target Classification Not Available

    This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.