Human TAZ/BTHS/CMD3A ORF/cDNA clone-Adenovirus particle (NM_181311.3)
Cat. No.: vGMAP-SPh-162
Pre-made Human TAZ/BTHS/CMD3A Adenovirus for TAZ overexpression in-vitro and in-vivo. The TAZ adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TAZ-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
TAZ/BTHS products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAP-SPh-162 | Human TAZ Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAP-SPh-162 |
Gene Name | TAZ |
Accession Number | NM_181311.3 |
Gene ID | 6901 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 789 bp |
Gene Alias | BTHS,CMD3A,EFE,EFE2,G4.5,LVNCX,Taz1 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCTCTGCACGTGAAGTGGCCGTTCCCCGCGGTGCCGCCGCTCACCTGGACCCTGGCCAGCAGCGTCGTCATGGGCTTGGTGGGCACCTACAGCTGCTTCTGGACCAAGTACATGAACCACCTGACCGTGCACAACAGGGAGGTGCTGTACGAGCTCATCGAGAAGCGAGGCCCGGCCACGCCCCTCATCACCGTGTCCAATCACCAGTCCTGCATGGACGACCCTCATCTCTGGGGGATCCTGAAACTCCGCCACATCTGGAACCTGAAGTTGATGCGTTGGACCCCTGCAGCTGCAGACATCTGCTTCACCAAGGAGCTACACTCCCACTTCTTCAGCTTGGGCAAGTGTGTGCCTGTGTGCCGAGGAGATGGCGTCTACCAGAAGGGGATGGACTTCATTTTGGAGAAGCTCAACCATGGGGACTGGGTGCATATCTTCCCAGAAGGGAAAGTGAACATGAGTTCCGAATTCCTGCGTTTCAAGTGGGGAATCGGGCGCCTGATTGCTGAGTGTCATCTCAACCCCATCATCCTGCCCCTGTGGCATGTCGGAATGAATGACGTCCTTCCTAACAGTCCGCCCTACTTCCCCCGCTTTGGACAGAAAATCACTGTGCTGATCGGGAAGCCCTTCAGTGCCCTGCCTGTACTCGAGCGGCTCCGGGCGGAGAACAAGTCGGCTGTGGAGATGCGGAAAGCCCTGACGGACTTCATTCAAGAGGAATTCCAGCATCTGAAGACTCAGGCAGAGCAGCTCCACAACCACCTCCAGCCTGGGAGATAG |
ORF Protein Sequence | MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1886-Ab | Anti-TAZ monoclonal antibody |
Target Antigen | GM-Tg-g-IP1886-Ag | TAZ protein |
ORF Viral Vector | pGMLP000972 | Human TAZ Lentivirus plasmid |
ORF Viral Vector | pGMLV002294 | Human TAFAZZIN Lentivirus plasmid |
ORF Viral Vector | pGMAD000588 | Human TAZ Adenovirus plasmid |
ORF Viral Vector | pGMLP-SPh-022 | Human TAZ Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-162 | Human TAZ Adenovirus plasmid |
ORF Viral Vector | vGMLP000972 | Human TAZ Lentivirus particle |
ORF Viral Vector | vGMLV002294 | Human TAFAZZIN Lentivirus particle |
ORF Viral Vector | vGMAD000588 | Human TAZ Adenovirus particle |
ORF Viral Vector | vGMLP-SPh-022 | Human TAZ Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-162 | Human TAZ Adenovirus particle |
Target information
Target ID | GM-IP1886 |
Target Name | TAZ |
Gene ID | 6901, 66826, 574297, 363521, 101084092, 119868552, 515177, 100058306 |
Gene Symbol and Synonyms | 5031411C02Rik,9130012G04Rik,BTHS,CMD3A,EFE,EFE2,G4.5,LVNCX,TAFAZZIN,TAZ,Taz1 |
Uniprot Accession | Q16635 |
Uniprot Entry Name | TAZ_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000102125 |
Target Classification | Not Available |
This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.