Human CGA/CG-ALPHA/FSHA ORF/cDNA clone-Adenovirus particle (BC020782)
Cat. No.: vGMAP000267
Pre-made Human CGA/CG-ALPHA/FSHA Adenovirus for CGA overexpression in-vitro and in-vivo. The CGA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CGA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
CGA/CG-ALPHA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000267 | Human CGA Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000267 |
| Gene Name | CGA |
| Accession Number | BC020782 |
| Gene ID | 1081 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 351 bp |
| Gene Alias | CG-ALPHA,FSHA,GPHa,GPHA1,HCG,LHA,TSHA |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGATTACTACAGAAAATATGCAGCTATCTTTCTGGTCACATTGTCGGTGTTTCTGCATGTTCTCCATTCCGCTCCTGATGTGCAGGATTGCCCAGAATGCACGCTACAGGAAAACCCATTCTTCTCCCAGCCGGGTGCCCCAATACTTCAGTGCATGGGCTGCTGCTTCTCTAGAGCATATCCCACTCCACTAAGGTCCAAGAAGACGATGTTGGTCCAAAAGAACGTCACCTCAGAGTCCACTTGCTGTGTAGCTAAATCATATAACAGGGTCACAGTAATGGGGGGTTTCAAAGTGGAGAACCACACGGCGTGCCACTGCAGTACTTGTTATTATCACAAATCTTAA |
| ORF Protein Sequence | MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T16650-Ab | Anti-GLHA/ CGA/ CG-ALPHA functional antibody |
| Target Antigen | GM-Tg-g-T16650-Ag | CGA protein |
| ORF Viral Vector | pGMAP000121 | Human CGA Adenovirus plasmid |
| ORF Viral Vector | pGMAP000267 | Human CGA Adenovirus plasmid |
| ORF Viral Vector | vGMAP000121 | Human CGA Adenovirus particle |
| ORF Viral Vector | vGMAP000267 | Human CGA Adenovirus particle |
Target information
| Target ID | GM-T16650 |
| Target Name | CGA |
| Gene ID | 1081, 12640, 697859, 116700, 751819, 403483, 280749, 100034174 |
| Gene Symbol and Synonyms | aGSU,alpha-GSU,alphaGSU,alphaSU,CG,CG-ALPHA,CGA,FSH-alpha,FSHA,GPA1,GPHa,GPHA1,GPHalpha,HCG,LHA,LSH-alpha,TSH-alpha,TSHA |
| Uniprot Accession | P01215 |
| Uniprot Entry Name | GLHA_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Drug Abuse |
| Gene Ensembl | ENSG00000135346 |
| Target Classification | Not Available |
The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


