Human APOH/BG ORF/cDNA clone-Adenovirus particle (BC020703)
Cat. No.: vGMAP000271
Pre-made Human APOH/BG Adenovirus for APOH overexpression in-vitro and in-vivo. The APOH adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified APOH-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
APOH/BG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000271 | Human APOH Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000271 |
| Gene Name | APOH |
| Accession Number | BC020703 |
| Gene ID | 350 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 1038 bp |
| Gene Alias | BG |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGATTTCTCCAGTGCTCATCTTGTTCTCGAGTTTTCTCTGCCATGTTGCTATTGCAGGACGGACCTGTCCCAAGCCAGATGATTTACCATTTTCCACAGTGGTCCCGTTAAAAACATTCTATGAGCCAGGAGAAGAGATTACGTATTCCTGCAAGCCGGGCTATGTGTCCCGAGGAGGGATGAGAAAGTTTATCTGCCCTCTCACAGGACTGTGGCCCATCAACACTCTGAAATGTACACCCAGAGTATGTCCTTTTGCTGGAATCTTAGAAAATGGAGCCGTACGCTATACGACTTTTGAATATCCCAACACGATCAGTTTTTCTTGTAACACTGGGTTTTATCTGAATGGCGCTGATTCTGCCAAGTGCACTGAGGAAGGAAAATGGAGCCCGGAGCTTCCTGTCTGTGCTCCCATCATCTGCCCTCCACCATCCATACCTACGTTTGCAACACTTCGTGTTTATAAGCCATCAGCTGGAAACAATTCCCTCTATCGGGACACAGCAGTTTTTGAATGTTTGCCACAACATGCGATGTTTGGAAATGATACAATTACCTGCACGACACATGGAAATTGGACTAAATTACCAGAATGCAGGGAAGTAAAATGCCCATTCCCATCAAGACCAGACAATGGATTTGTGAACTATCCTGCAAAACCAACACTTTATTACAAGGATAAAGCCACATTTGGCTGCCATGATGGATATTCTCTGGATGGCCCGGAAGAAATAGAATGTACCAAACTGGGAAACTGGTCTGCCATGCCAAGTTGTAAAGCATCTTGTAAAGTACCTGTGAAAAAAGCCACTGTGGTGTACCAAGGAGAGAGAGTAAAGATTCAGGAAAAATTTAAGAATGGAATGCTACATGGTGATAAAGTTTCTTTCTTCTGCAAAAATAAGGAAAAGAAGTGTAGCTATACAGAGGATGCTCAGTGTATAGATGGCACTATCGAAGTCCCCAAATGCTTCAAGGAACACAGTTCTCTGGCTTTTTGGAAAACTGATGCATCCGATGTAAAGCCATGCTAA |
| ORF Protein Sequence | MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T86885-Ab | Anti-APOH/ B2G1/ B2GP1 functional antibody |
| Target Antigen | GM-Tg-g-T86885-Ag | APOH protein |
| ORF Viral Vector | pGMLP000456 | Human APOH Lentivirus plasmid |
| ORF Viral Vector | pGMAP000271 | Human APOH Adenovirus plasmid |
| ORF Viral Vector | vGMLP000456 | Human APOH Lentivirus particle |
| ORF Viral Vector | vGMAP000271 | Human APOH Adenovirus particle |
Target information
| Target ID | GM-T86885 |
| Target Name | APOH |
| Gene ID | 350, 11818, 718645, 287774, 101080593, 403945, 281006, 100063250 |
| Gene Symbol and Synonyms | APOH,B2G1,B2GP1,B2GPI,beta-2-GPI,beta2-GPI,BG |
| Uniprot Accession | P02749 |
| Uniprot Entry Name | APOH_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000091583 |
| Target Classification | Not Available |
Apolipoprotein H, also known as beta-2-glycoprotein I, is a component of circulating plasma lipoproteins. It has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, hemostasis, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome (APS). The anti-beta (2) glycoprotein I antibodies from APS patients, mediate inhibition of activated protein C which has anticoagulant properties. Because beta-2-GPI is the main autoantigen in patients with APS, the disruption of this pathway by autoantibodies may be an important mechanism for thrombosis in patients with APS.[provided by RefSeq, Dec 2019]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


