Human IL1F10/FIL1-theta/FKSG75 ORF/cDNA clone-Lentivirus particle (NM_173161)

Cat. No.: vGMLP-IL-003

Pre-made Human IL1F10/FIL1-theta/FKSG75 Lentiviral expression plasmid for IL1F10 lentivirus packaging, IL1F10 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IL1F10/FIL1-theta products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP-IL-003 Human IL1F10 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP-IL-003
Gene Name IL1F10
Accession Number NM_173161
Gene ID 84639
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 459 bp
Gene Alias FIL1-theta,FKSG75,IL-1HY2,IL-38,IL1-theta,IL1HY2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGTTCCCTCCCCATGGCAAGATACTACATAATTAAATATGCAGACCAGAAGGCTCTATACACAAGAGATGGCCAGCTGCTGGTGGGAGATCCTGTTGCAGACAACTGCTGTGCAGAGAAGATCTGCATACTTCCTAACAGAGGCTTGGCCCGCACCAAGGTCCCCATTTTCCTGGGGATCCAGGGAGGGAGCCGCTGCCTGGCATGTGTGGAGACAGAAGAGGGGCCTTCCCTACAGCTGGAGGATGTGAACATTGAGGAACTGTACAAAGGTGGTGAAGAGGCCACACGCTTCACCTTCTTCCAGAGCAGCTCAGGCTCCGCCTTCAGGCTTGAGGCTGCTGCCTGGCCTGGCTGGTTCCTGTGTGGCCCGGCAGAGCCCCAGCAGCCAGTACAGCTCACCAAGGAGAGTGAGCCCTCAGCCCGTACCAAGTTTTACTTTGAACAGAGCTGGTAG
ORF Protein Sequence MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1024-Ab Anti-IL1FA/ IL1F10/ FIL1-theta functional antibody
    Target Antigen GM-Tg-g-SE1024-Ag IL1F10 protein
    ORF Viral Vector pGMLP-IL-003 Human IL1F10 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-086 Human IL1F10 Adenovirus plasmid
    ORF Viral Vector vGMLP-IL-003 Human IL1F10 Lentivirus particle
    ORF Viral Vector vGMAP-IL-086 Human IL1F10 Adenovirus particle


    Target information

    Target ID GM-SE1024
    Target Name IL1F10
    Gene ID 84639, 215274, 100428875, 362077, 101096973, 611873, 615702, 100052532
    Gene Symbol and Synonyms FIL1-theta,FKSG75,IL-1HY2,IL-38,IL1-theta,IL1F10,IL1HY2
    Uniprot Accession Q8WWZ1
    Uniprot Entry Name IL1FA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000136697
    Target Classification Not Available

    The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 family members to regulate adapted and innate immune responses. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.