Human COX8A/COX/COX8 ORF/cDNA clone-Lentivirus particle (NM_004074)

Cat. No.: vGMLP000023

Pre-made Human COX8A/COX/COX8 Lentiviral expression plasmid for COX8A lentivirus packaging, COX8A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to COX/COX8A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000023 Human COX8A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000023
Gene Name COX8A
Accession Number NM_004074
Gene ID 1351
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 210 bp
Gene Alias COX,COX8,COX8-2,COX8L,VIII,VIII-L
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCGTCCTGACGCCGCTGCTGCTGCGGGGCTTGACAGGCTCGGCCCGGCGGCTCCCAGTGCCGCGCGCCAAGATCCATTCGTTGCCGCCGGAGGGGAAGCTTGGGATCATGGAATTGGCCGTTGGGCTTACCTCCTGCTTCGTGACCTTCCTCCTGCCAGCGGGCTGGATCCTGTCACACCTGGAGACCTACAGGAGGCCAGAGTGA
ORF Protein Sequence MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0264-Ab Anti-COX monoclonal antibody
    Target Antigen GM-Tg-g-IP0264-Ag COX/COX8A protein
    ORF Viral Vector pGMLP000023 Human COX8A Lentivirus plasmid
    ORF Viral Vector vGMLP000023 Human COX8A Lentivirus particle


    Target information

    Target ID GM-IP0264
    Target Name COX
    Gene ID 1351, 12868, 718007, 171335, 101096603, 476040, 281091, 111775959
    Gene Symbol and Synonyms COX,COX8,COX8-2,COX8A,COX8L,LOC111775959,MC4DN15,VIII,VIII-L
    Uniprot Accession P10176
    Uniprot Entry Name COX8A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Not Available
    Gene Ensembl ENSG00000176340
    Target Classification Checkpoint-Immuno Oncology

    The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.