Human TIMM17A/TIM17/TIM17A ORF/cDNA clone-Lentivirus particle (NM_006335)

Cat. No.: vGMLP000072

Pre-made Human TIMM17A/TIM17/TIM17A Lentiviral expression plasmid for TIMM17A lentivirus packaging, TIMM17A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TIMM17A/TIM17 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000072 Human TIMM17A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000072
Gene Name TIMM17A
Accession Number NM_006335
Gene ID 10440
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 516 bp
Gene Alias TIM17,TIM17A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGAGTACGCGCGAGAGCCTTGCCCATGGCGAATTGTGGATGACTGTGGTGGGGCCTTTACGATGGGTACCATTGGTGGTGGTATCTTTCAAGCAATCAAAGGTTTTCGCAATTCTCCAGTGGGAGTAAACCACAGACTACGAGGGAGTTTGACAGCTATTAAAACCAGGGCTCCACAGTTAGGAGGTAGCTTTGCAGTTTGGGGAGGGCTGTTTTCCATGATTGACTGTAGTATGGTTCAAGTCAGAGGAAAGGAAGATCCCTGGAACTCCATCACAAGTGGTGCCTTAACGGGAGCCATACTGGCAGCAAGAAATGGACCAGTGGCCATGGTTGGGTCAGCCGCAATGGGTGGCATTCTCCTAGCTTTAATTGAAGGAGCTGGTATCTTGTTGACAAGATTTGCCTCTGCACAGTTTCCCAATGGTCCTCAGTTTGCAGAAGACCCCTCCCAGTTGCCTTCAACTCAGTTACCTTCCTCACCTTTTGGAGACTATCGACAATATCAGTAG
ORF Protein Sequence MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1913-Ab Anti-TIMM17A monoclonal antibody
    Target Antigen GM-Tg-g-IP1913-Ag TIMM17A protein
    ORF Viral Vector pGMLP000072 Human TIMM17A Lentivirus plasmid
    ORF Viral Vector vGMLP000072 Human TIMM17A Lentivirus particle


    Target information

    Target ID GM-IP1913
    Target Name TIMM17A
    Gene ID 10440, 21854, 707001, 54311, 101097369, 480001, 509797, 100052076
    Gene Symbol and Synonyms mTim17a,TIM17,TIM17A,Timm17,TIMM17A
    Uniprot Accession Q99595
    Uniprot Entry Name TI17A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000134375
    Target Classification Not Available

    Predicted to contribute to protein transmembrane transporter activity. Predicted to be involved in protein import into mitochondrial matrix. Located in mitochondrial inner membrane and nucleoplasm. Is integral component of mitochondrial inner membrane. Part of TIM23 mitochondrial import inner membrane translocase complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.