Human IMP3/BRMS2/C15orf12 ORF/cDNA clone-Lentivirus particle (NM_018285)

Cat. No.: vGMLP000079

Pre-made Human IMP3/BRMS2/C15orf12 Lentiviral expression plasmid for IMP3 lentivirus packaging, IMP3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IMP3/BRMS2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000079 Human IMP3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000079
Gene Name IMP3
Accession Number NM_018285
Gene ID 55272
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 555 bp
Gene Alias BRMS2,C15orf12,MRPS4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGCGGAAGCTTAAGTTCCACGAGCAGAAGCTGCTGAAGCAGGTGGACTTCCTGAACTGGGAGGTCACCGACCACAACCTGCACGAGCTGCGCGTGCTGCGGCGTTACCGGCTGCAGCGGCGGGAGGACTACACGCGCTACAACCAGCTGAGCCGTGCCGTGCGTGAGCTGGCGCGGCGCCTGCGCGACCTGCCCGAACGCGACCAGTTCCGCGTGCGCGCTTCGGCCGCGCTGCTGGACAAGCTGTATGCTCTCGGCTTGGTGCCCACGCGCGGTTCGCTGGAGCTCTGCGACTTCGTCACGGCCTCGTCCTTCTGCCGCCGCCGCCTCCCCACCGTGCTCCTCAAGCTGCGCATGGCGCAGCACCTTCAGGCTGCCGTGGCCTTTGTGGAGCAAGGGCACGTACGCGTGGGCCCTGACGTGGTTACCGACCCCGCCTTCCTTGTCACGCGCAGCATGGAGGACTTTGTCACTTGGGTGGACTCGTCCAAGATCAAGCGGCACGTGCTAGAGTACAATGAGGAGCGCGATGACTTCGATCTGGAAGCCTAG
ORF Protein Sequence MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T64642-Ab Anti-IMP3 monoclonal antibody
    Target Antigen GM-Tg-g-T64642-Ag IMP3 protein
    ORF Viral Vector pGMLP000079 Human IMP3 Lentivirus plasmid
    ORF Viral Vector vGMLP000079 Human IMP3 Lentivirus particle


    Target information

    Target ID GM-T64642
    Target Name IMP3
    Gene ID 55272, 102462, 706202, 315697, 101097730, 487656, 511560, 102149534
    Gene Symbol and Synonyms 1190002L16Rik,BRMS2,C15orf12,IMP3,MRPS4,RGD1306825
    Uniprot Accession Q9NV31
    Uniprot Entry Name IMP3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000177971
    Target Classification Not Available

    This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.