Human DEFA1/DEF1/DEFA2 ORF/cDNA clone-Lentivirus particle (NM_004084)
Cat. No.: vGMLP000150
Pre-made Human DEFA1/DEF1/DEFA2 Lentiviral expression plasmid for DEFA1 lentivirus packaging, DEFA1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
DEFA1/DEF1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000150 | Human DEFA1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000150 |
Gene Name | DEFA1 |
Accession Number | NM_004084 |
Gene ID | 1667 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 285 bp |
Gene Alias | DEF1,DEFA2,HNP-1,HP-1,HP1,MRS |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGGACCCTCGCCATCCTTGCTGCCATTCTCCTGGTGGCCCTGCAGGCCCAGGCTGAGCCACTCCAGGCAAGAGCTGATGAGGTTGCTGCAGCCCCGGAGCAGATTGCAGCGGACATCCCAGAAGTGGTTGTTTCCCTTGCATGGGACGAAAGCTTGGCTCCAAAGCATCCAGGCTCAAGGAAAAACATGGCCTGCTATTGCAGAATACCAGCGTGCATTGCAGGAGAACGTCGCTATGGAACCTGCATCTACCAGGGAAGACTCTGGGCATTCTGCTGCTGA |
ORF Protein Sequence | MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0849-Ab | Anti-DEF1/ DEFA1/ DEFA2 functional antibody |
Target Antigen | GM-Tg-g-SE0849-Ag | DEFA1 protein |
ORF Viral Vector | pGMLP000150 | Human DEFA1 Lentivirus plasmid |
ORF Viral Vector | pGMLP004901 | Human DEFA1B Lentivirus plasmid |
ORF Viral Vector | vGMLP000150 | Human DEFA1 Lentivirus particle |
ORF Viral Vector | vGMLP004901 | Human DEFA1B Lentivirus particle |
Target information
Target ID | GM-SE0849 |
Target Name | DEFA1 |
Gene ID | 1667 |
Gene Symbol and Synonyms | DEF1,DEFA1,DEFA2,HNP-1,HP-1,HP1,MRS |
Uniprot Accession | P59665 |
Uniprot Entry Name | DEF1_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Diagnostics Biomarker |
Disease | Not Available |
Gene Ensembl | ENSG00000206047 |
Target Classification | Not Available |
Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation. [provided by RefSeq, Oct 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.