Human G0S2 ORF/cDNA clone-Lentivirus particle (NM_015714)

Cat. No.: vGMLP000171

Pre-made Human G0S2/ Lentiviral expression plasmid for G0S2 lentivirus packaging, G0S2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to G0S2/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000171 Human G0S2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000171
Gene Name G0S2
Accession Number NM_015714
Gene ID 50486
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 312 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAACGGTCCAGGAGCTGATCCCCCTGGCCAAGGAGATGATGGCCCAGAAGCGCAAGGGGAAGATGGTGAAGCTGTACGTGCTGGGCAGCGTGCTGGCCCTCTTCGGCGTGGTGCTCGGCCTGATGGAGACTGTGTGCAGCCCCTTCACGGCCGCCAGACGTCTGCGGGACCAGGAGGCAGCCGTGGCGGAGCTGCAGGCCGCCCTGGAGCGACAGGCTCTCCAGAAGCAAGCCCTGCAGGAGAAAGGCAAGCAGCAGGACACGGTCCTCGGCGGCCGGGCCCTGTCCAACCGGCAGCACGCCTCCTAG
ORF Protein Sequence METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0876-Ab Anti-G0S2 monoclonal antibody
    Target Antigen GM-Tg-g-IP0876-Ag G0S2 protein
    ORF Viral Vector pGMLP000171 Human G0S2 Lentivirus plasmid
    ORF Viral Vector vGMLP000171 Human G0S2 Lentivirus particle


    Target information

    Target ID GM-IP0876
    Target Name G0S2
    Gene ID 50486, 14373, 717581, 289388, 101088385, 609704, 507436, 100056475
    Gene Symbol and Synonyms G0S2
    Uniprot Accession P27469
    Uniprot Entry Name G0S2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000123689
    Target Classification Not Available

    Involved in extrinsic apoptotic signaling pathway and positive regulation of extrinsic apoptotic signaling pathway. Located in mitochondrion. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.