Human EDDM3A/EP3A/FAM12A ORF/cDNA clone-Lentivirus particle (NM_006683.4)
Cat. No.: vGMLP000206
Pre-made Human EDDM3A/EP3A/FAM12A Lentiviral expression plasmid for EDDM3A lentivirus packaging, EDDM3A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
EDDM3A/EP3A products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000206 | Human EDDM3A Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000206 |
Gene Name | EDDM3A |
Accession Number | NM_006683.4 |
Gene ID | 10876 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 444 bp |
Gene Alias | EP3A,FAM12A,HE3-ALPHA,HE3A,HE3ALPHA,RAM1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACATCCTCTCTAAAGATTTGGGGCATACTCTTGGCCCTGCTTTGCATCCTTTGCAGGCTGTGTGTATACAGTAACAACATTTACTGGAGAGAATTCATAAAACTTCATTACTTAAGTCCAAGTCGAGAATTCAAAGAGTACAAATGTGATGTCCTCATGAGAGAAAAAGAGGCTCTGAAAGGCAAGAGCTTTCATATGTTCATCTATAGCTTATGGTTCAAAATTCAGCGTGCATGCATCAATGAGAAGGGGAGCGACCGATATAGAAATGCATATGTATGGGCCCCAGGTGCCCTCAAAGTACTCGAGTGTCACTGGGAGAAGTACAACAATAGGTACACAGAGAGCAGAAGCTTCAGCTACATTGAATTCCATTGTGGCGTAGATGGATATGTTGATAACATAGAAGACCTGAGGATTATAGAACCTATCAGCAACTAG |
ORF Protein Sequence | MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLRIIEPISN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0165-Ab | Anti-EP3A/ EDDM3A/ FAM12A functional antibody |
Target Antigen | GM-Tg-g-SE0165-Ag | EDDM3A protein |
ORF Viral Vector | pGMLP000206 | Human EDDM3A Lentivirus plasmid |
ORF Viral Vector | vGMLP000206 | Human EDDM3A Lentivirus particle |
Target information
Target ID | GM-SE0165 |
Target Name | EDDM3A |
Gene ID | 10876, 704355 |
Gene Symbol and Synonyms | EDDM3A,EP3A,FAM12A,HE3-ALPHA,HE3A,HE3ALPHA,RAM1 |
Uniprot Accession | Q14507 |
Uniprot Entry Name | EP3A_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000181562 |
Target Classification | Not Available |
Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.