Human AIF1/AIF-1/IBA1 ORF/cDNA clone-Lentivirus particle (NM_001623)

Cat. No.: vGMLP000282

Pre-made Human AIF1/AIF-1/IBA1 Lentiviral expression plasmid for AIF1 lentivirus packaging, AIF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to AIF1/AIF-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000282 Human AIF1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000282
Gene Name AIF1
Accession Number NM_001623
Gene ID 199
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 444 bp
Gene Alias AIF-1,IBA1,IRT-1,IRT1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCCAAACCAGGGATTTACAGGGAGGAAAAGCTTTCGGACTGCTGAAGGCCCAGCAGGAAGAGAGGCTGGATGAGATCAACAAGCAATTCCTAGACGATCCCAAATATAGCAGTGATGAGGATCTGCCCTCCAAACTGGAAGGCTTCAAAGAGAAATACATGGAGTTTGACCTTAATGGAAATGGCGATATTGATATCATGTCCCTGAAACGAATGCTGGAGAAACTTGGAGTCCCCAAGACTCACCTAGAGCTAAAGAAATTAATTGGAGAGGTGTCCAGTGGCTCCGGGGAGACGTTCAGCTACCCTGACTTTCTCAGGATGATGCTGGGCAAGAGATCTGCCATCCTAAAAATGATCCTGATGTATGAGGAAAAAGCGAGAGAAAAGGAAAAGCCAACAGGCCCCCCAGCCAAGAAAGCTATCTCTGAGTTGCCCTGA
ORF Protein Sequence MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T30777-Ab Anti-AIF1 monoclonal antibody
    Target Antigen GM-Tg-g-T30777-Ag AIF1 protein
    ORF Viral Vector pGMLP000282 Human AIF1 Lentivirus plasmid
    ORF Viral Vector vGMLP000282 Human AIF1 Lentivirus particle


    Target information

    Target ID GM-T30777
    Target Name AIF1
    Gene ID 199, 11629, 574115, 29427, 101085631, 474841, 280989, 100050158
    Gene Symbol and Synonyms AIF,AIF-1,AIF1,BART-1,Bart1,D17H6S50E,G1,IBA1,IRT-1,IRT1,mrf-1
    Uniprot Accession P55008
    Uniprot Entry Name AIF1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000204472
    Target Classification Not Available

    This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.