Human ARL2/ARFL2 ORF/cDNA clone-Lentivirus particle (NM_001667)

Cat. No.: vGMLP000288

Pre-made Human ARL2/ARFL2 Lentiviral expression plasmid for ARL2 lentivirus packaging, ARL2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ARL2/ARFL2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000288 Human ARL2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000288
Gene Name ARL2
Accession Number NM_001667
Gene ID 402
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 555 bp
Gene Alias ARFL2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCTCCTGACCATTCTGAAGAAGATGAAGCAGAAAGAGCGGGAGCTGCGACTGCTCATGCTTGGCCTGGACAATGCTGGAAAGACAACCATCCTGAAGAAGTTCAATGGGGAGGACATCGACACCATCTCCCCAACGCTGGGCTTCAACATCAAGACCCTGGAGCACCGAGGATTCAAGCTGAACATCTGGGATGTGGGTGGCCAGAAGTCCCTGCGGTCCTACTGGCGGAACTACTTTGAGAGCACCGATGGCCTCATCTGGGTAGTGGACAGCGCAGACCGCCAGCGCATGCAGGACTGCCAGCGGGAGCTCCAGAGCCTGCTGGTGGAGGAGCGCCTGGCCGGAGCAACCCTCCTCATCTTTGCTAATAAGCAGGACCTGCCTGGAGCACTGTCCTCTAACGCCATCCGCGAGGTCCTGGAGCTGGACTCCATCCGCAGCCACCACTGGTGCATCCAGGGCTGCAGCGCCGTCACCGGGGAGAACCTGCTGCCGGGCATCGACTGGCTCCTGGATGACATTTCCAGCCGCATTTTCACAGCTGACTGA
ORF Protein Sequence MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T95553-Ab Anti-ARL2 monoclonal antibody
    Target Antigen GM-Tg-g-T95553-Ag ARL2 protein
    ORF Viral Vector pGMLP000288 Human ARL2 Lentivirus plasmid
    ORF Viral Vector vGMLP000288 Human ARL2 Lentivirus particle


    Target information

    Target ID GM-T95553
    Target Name ARL2
    Gene ID 402, 56327, 722013, 65142, 101081671, 483753, 511349, 100056286
    Gene Symbol and Synonyms 2610009M23Rik,ARFL2,ARL2,MRCS1
    Uniprot Accession P36404
    Uniprot Entry Name ARL2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000213465
    Target Classification Not Available

    This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.