Human BIK/BIP1/BP4 ORF/cDNA clone-Lentivirus particle (NM_001197)
Cat. No.: vGMLP000354
Pre-made Human BIK/BIP1/BP4 Lentiviral expression plasmid for BIK lentivirus packaging, BIK lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
BIK/BIP1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000354 | Human BIK Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000354 |
| Gene Name | BIK |
| Accession Number | NM_001197 |
| Gene ID | 638 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 483 bp |
| Gene Alias | BIP1,BP4,NBK |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCTGAAGTAAGACCCCTCTCCAGAGACATCTTGATGGAGACCCTCCTGTATGAGCAGCTCCTGGAACCCCCGACCATGGAGGTTCTTGGCATGACTGACTCTGAAGAGGACCTGGACCCTATGGAGGACTTCGATTCTTTGGAATGCATGGAGGGCAGTGACGCATTGGCCCTGCGGCTGGCCTGCATCGGGGACGAGATGGACGTGAGCCTCAGGGCCCCGCGCCTGGCCCAGCTCTCCGAGGTGGCCATGCACAGCCTGGGTCTGGCTTTCATCTACGACCAGACTGAGGACATCAGGGATGTTCTTAGAAGTTTCATGGACGGTTTCACCACACTTAAGGAGAACATAATGAGGTTCTGGAGATCCCCGAACCCCGGGTCCTGGGTGTCCTGCGAACAGGTGCTGCTGGCGCTGCTGCTGCTGCTGGCGCTGCTGCTGCCGCTGCTCAGCGGGGGCCTGCACCTGCTGCTCAAGTGA |
| ORF Protein Sequence | MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0421-Ab | Anti-BIK monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0421-Ag | BIK protein |
| ORF Viral Vector | pGMLP000354 | Human BIK Lentivirus plasmid |
| ORF Viral Vector | vGMLP000354 | Human BIK Lentivirus particle |
Target information
| Target ID | GM-IP0421 |
| Target Name | BIK |
| Gene ID | 638, 12124, 711479, 114496, 790946, 102155535, 102150906 |
| Gene Symbol and Synonyms | BIK,Biklk,BIP1,Blk,BP4,NBK |
| Uniprot Accession | Q13323 |
| Uniprot Entry Name | BIK_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Cancer |
| Gene Ensembl | ENSG00000100290 |
| Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins. [provided by RefSeq, Sep 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


