Human BIK/BIP1/BP4 ORF/cDNA clone-Lentivirus particle (NM_001197)

Cat. No.: vGMLP000354

Pre-made Human BIK/BIP1/BP4 Lentiviral expression plasmid for BIK lentivirus packaging, BIK lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to BIK/BIP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000354 Human BIK Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000354
Gene Name BIK
Accession Number NM_001197
Gene ID 638
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 483 bp
Gene Alias BIP1,BP4,NBK
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGAAGTAAGACCCCTCTCCAGAGACATCTTGATGGAGACCCTCCTGTATGAGCAGCTCCTGGAACCCCCGACCATGGAGGTTCTTGGCATGACTGACTCTGAAGAGGACCTGGACCCTATGGAGGACTTCGATTCTTTGGAATGCATGGAGGGCAGTGACGCATTGGCCCTGCGGCTGGCCTGCATCGGGGACGAGATGGACGTGAGCCTCAGGGCCCCGCGCCTGGCCCAGCTCTCCGAGGTGGCCATGCACAGCCTGGGTCTGGCTTTCATCTACGACCAGACTGAGGACATCAGGGATGTTCTTAGAAGTTTCATGGACGGTTTCACCACACTTAAGGAGAACATAATGAGGTTCTGGAGATCCCCGAACCCCGGGTCCTGGGTGTCCTGCGAACAGGTGCTGCTGGCGCTGCTGCTGCTGCTGGCGCTGCTGCTGCCGCTGCTCAGCGGGGGCCTGCACCTGCTGCTCAAGTGA
ORF Protein Sequence MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0421-Ab Anti-BIK monoclonal antibody
    Target Antigen GM-Tg-g-IP0421-Ag BIK protein
    ORF Viral Vector pGMLP000354 Human BIK Lentivirus plasmid
    ORF Viral Vector vGMLP000354 Human BIK Lentivirus particle


    Target information

    Target ID GM-IP0421
    Target Name BIK
    Gene ID 638, 12124, 711479, 114496, 790946, 102155535, 102150906
    Gene Symbol and Synonyms BIK,Biklk,BIP1,Blk,BP4,NBK
    Uniprot Accession Q13323
    Uniprot Entry Name BIK_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000100290
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins. [provided by RefSeq, Sep 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.