Human RPP14/P14 ORF/cDNA clone-Lentivirus particle (NM_007042)

Cat. No.: vGMLP000371

Pre-made Human RPP14/P14 Lentiviral expression plasmid for RPP14 lentivirus packaging, RPP14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RPP14/P14 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000371 Human RPP14 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000371
Gene Name RPP14
Accession Number NM_007042
Gene ID 11102
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 375 bp
Gene Alias P14
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTGCCCCTGCTGCCACATATGAAAGAGTAGTTTACAAAAACCCTTCCGAGTACCACTACATGAAAGTCTGCCTAGAATTTCAAGATTGTGGAGTTGGACTGAATGCTGCACAGTTCAAACAGCTGCTTATTTCGGCTGTGAAGGACCTGTTTGGGGAGGTTGATGCCGCCTTACCTTTGGACATCCTAACCTATGAAGAGAAGACCTTGTCAGCCATCTTGAGAATATGTAGCAGTGGTCTTGTCAAATTGTGGAGCTCTTTGACCCTGTTAGGATCCTATAAAGGCAAAAAATGTGCTTTCCGGGTGATTCAGGTTTCTCCATTTCTTCTTGCATTATCTGGTAATAGTAGGGAACTAGTATTGGATTGA
ORF Protein Sequence MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA047-Ab Anti-RPP14 monoclonal antibody
    Target Antigen GM-Tg-g-TA047-Ag RPP14 protein
    ORF Viral Vector pGMLP000371 Human RPP14 Lentivirus plasmid
    ORF Viral Vector vGMLP000371 Human RPP14 Lentivirus particle


    Target information

    Target ID GM-TA047
    Target Name RPP14
    Gene ID 11102, 67053, 706788, 361020, 101099867, 612771, 515208, 100630485
    Gene Symbol and Synonyms 2610511E03Rik,P14,RPP14
    Uniprot Accession O95059
    Uniprot Entry Name RPP14_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000163684
    Target Classification Not Available

    This gene encodes a subunit of ribonuclease P and has 3' to 5' exoribonuclease activity. Transcripts for this gene are bicistronic and include a conserved downstream open reading frame for the hydroxyacyl-thioester dehydratase type 2 (HTD2) gene. [provided by RefSeq, May 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.