Human CISD2/ERIS/Miner1 ORF/cDNA clone-Lentivirus particle (NM_001008388)
Cat. No.: vGMLP000388
Pre-made Human CISD2/ERIS/Miner1 Lentiviral expression plasmid for CISD2 lentivirus packaging, CISD2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CISD2/ERIS products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000388 | Human CISD2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000388 |
| Gene Name | CISD2 |
| Accession Number | NM_001008388 |
| Gene ID | 493856 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 408 bp |
| Gene Alias | ERIS,Miner1,NAF-1,WFS2,ZCD2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGTGCTGGAGAGCGTGGCCCGTATCGTGAAGGTGCAGCTCCCTGCATATCTGAAGCGGCTCCCAGTCCCTGAAAGCATTACCGGGTTCGCTAGGCTCACAGTTTCAGAATGGCTTCGGTTATTGCCTTTCCTTGGTGTACTCGCACTTCTTGGCTACCTTGCAGTTCGTCCATTCCTCCCGAAGAAGAAACAACAGAAGGATAGCTTGATTAATCTTAAAATACAAAAGGAAAATCCGAAAGTAGTGAATGAAATAAACATTGAAGATTTGTGTCTTACTAAAGCAGCTTATTGTAGGTGTTGGCGTTCTAAAACGTTTCCTGCCTGCGATGGTTCACATAATAAACACAATGAATTGACAGGAGATAATGTGGGTCCACTAATACTGAAGAAGAAAGAAGTATAA |
| ORF Protein Sequence | MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0551-Ab | Anti-CISD2 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0551-Ag | CISD2 protein |
| ORF Viral Vector | pGMLP000388 | Human CISD2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000388 | Human CISD2 Lentivirus particle |
Target information
| Target ID | GM-IP0551 |
| Target Name | CISD2 |
| Gene ID | 493856, 67006, 100429989, 295457, 101094592, 106558129, 781260, 100630458 |
| Gene Symbol and Synonyms | 1500009M05Rik,1500026J14Rik,1500031D15Rik,B630006A20Rik,CISD2,ERIS,Miner1,NAF-1,Noxp70,RGD1566242,WFS2,ZCD2 |
| Uniprot Accession | Q8N5K1 |
| Uniprot Entry Name | CISD2_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000145354 |
| Target Classification | Not Available |
The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2. [provided by RefSeq, Mar 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


