Human CISD2/ERIS/Miner1 ORF/cDNA clone-Lentivirus particle (NM_001008388)

Cat. No.: vGMLP000388

Pre-made Human CISD2/ERIS/Miner1 Lentiviral expression plasmid for CISD2 lentivirus packaging, CISD2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CISD2/ERIS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000388 Human CISD2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000388
Gene Name CISD2
Accession Number NM_001008388
Gene ID 493856
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 408 bp
Gene Alias ERIS,Miner1,NAF-1,WFS2,ZCD2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGCTGGAGAGCGTGGCCCGTATCGTGAAGGTGCAGCTCCCTGCATATCTGAAGCGGCTCCCAGTCCCTGAAAGCATTACCGGGTTCGCTAGGCTCACAGTTTCAGAATGGCTTCGGTTATTGCCTTTCCTTGGTGTACTCGCACTTCTTGGCTACCTTGCAGTTCGTCCATTCCTCCCGAAGAAGAAACAACAGAAGGATAGCTTGATTAATCTTAAAATACAAAAGGAAAATCCGAAAGTAGTGAATGAAATAAACATTGAAGATTTGTGTCTTACTAAAGCAGCTTATTGTAGGTGTTGGCGTTCTAAAACGTTTCCTGCCTGCGATGGTTCACATAATAAACACAATGAATTGACAGGAGATAATGTGGGTCCACTAATACTGAAGAAGAAAGAAGTATAA
ORF Protein Sequence MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0551-Ab Anti-CISD2 monoclonal antibody
    Target Antigen GM-Tg-g-IP0551-Ag CISD2 protein
    ORF Viral Vector pGMLP000388 Human CISD2 Lentivirus plasmid
    ORF Viral Vector vGMLP000388 Human CISD2 Lentivirus particle


    Target information

    Target ID GM-IP0551
    Target Name CISD2
    Gene ID 493856, 67006, 100429989, 295457, 101094592, 106558129, 781260, 100630458
    Gene Symbol and Synonyms 1500009M05Rik,1500026J14Rik,1500031D15Rik,B630006A20Rik,CISD2,ERIS,Miner1,NAF-1,Noxp70,RGD1566242,WFS2,ZCD2
    Uniprot Accession Q8N5K1
    Uniprot Entry Name CISD2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000145354
    Target Classification Not Available

    The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2. [provided by RefSeq, Mar 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.