Human COQ7/CAT5/CLK-1 ORF/cDNA clone-Lentivirus particle (NM_016138)

Cat. No.: vGMLP000431

Pre-made Human COQ7/CAT5/CLK-1 Lentiviral expression plasmid for COQ7 lentivirus packaging, COQ7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to COQ7/CAT5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000431 Human COQ7 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000431
Gene Name COQ7
Accession Number NM_016138
Gene ID 10229
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 654 bp
Gene Alias CAT5,CLK-1,CLK1,COQ10D8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTTGCGCCGGGGCGGCGGCGGCTCCCCGCCTTTGGCGGCTGCGCCCGGGGGCCCGGCGGTCCCTCTCAGCTTATGGAAGAAGAACCAGTGTCAGATTTCGCAGTTCAGGAATGACTTTAGACAATATCAGTCGGGCAGCTGTGGATCGAATAATCCGGGTGGATCATGCAGGCGAATATGGAGCAAACCGCATCTATGCCGGGCAGATGGCTGTCCTGGGTCGGACCAGCGTCGGGCCAGTCATTCAGAAAATGTGGGATCAAGAAAAGGACCATTTGAAAAAGTTCAATGAGTTGATGGTTACGTTCAGGGTCCGGCCAACAGTTCTGATGCCCTTGTGGAACGTGCTGGGGTTTGCACTGGGGGCGGGGACCGCCTTGCTCGGGAAGGAAGGTGCCATGGCCTGCACCGTGGCGGTGGAAGAGAGCATAGCACATCACTACAACAACCAGATCAGGACGCTGATGGAGGAGGACCCTGAAAAATACGAGGAACTTCTTCAGCTGATAAAGAAATTTCGGGATGAAGAGCTTGAGCACCATGACATAGGCCTCGACCATGATGCAGAATTGGCTCCAGCCTATGCCGTCCTGAAGAGCATTATCCAGGCCGGATGCAGAGTGGCGATATATTTATCAGAAAGATTATAA
ORF Protein Sequence MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2432-Ab Anti-COQ7 monoclonal antibody
    Target Antigen GM-Tg-g-IP2432-Ag COQ7 protein
    ORF Viral Vector pGMLP000431 Human COQ7 Lentivirus plasmid
    ORF Viral Vector vGMLP000431 Human COQ7 Lentivirus particle


    Target information

    Target ID GM-IP2432
    Target Name COQ7
    Gene ID 10229, 12850, 693931, 25249, 101085941, 479828, 504771, 100050077
    Gene Symbol and Synonyms CAT5,CLK-1,CLK1,COQ10D8,COQ7
    Uniprot Accession Q99807
    Uniprot Entry Name COQ7_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000167186
    Target Classification Not Available

    The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.