Human PRDX4/AOE37-2/AOE372 ORF/cDNA clone-Lentivirus particle (NM_006406)
Cat. No.: vGMLP000443
Pre-made Human PRDX4/AOE37-2/AOE372 Lentiviral expression plasmid for PRDX4 lentivirus packaging, PRDX4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PRDX4/AOE37-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000443 | Human PRDX4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000443 |
Gene Name | PRDX4 |
Accession Number | NM_006406 |
Gene ID | 10549 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 816 bp |
Gene Alias | AOE37-2,AOE372,HEL-S-97n,PRX-4 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGGCGCTGCCGCTGCTAGCCGCGACAACTCCGGACCACGGCCGCCACCGAAGGCTGCTTCTGCTGCCGCTACTGCTGTTCCTGCTGCCGGCTGGAGCTGTGCAGGGCTGGGAGACAGAGGAGAGGCCCCGGACTCGCGAAGAGGAGTGCCACTTCTACGCGGGTGGACAAGTGTACCCGGGAGAGGCATCCCGGGTATCGGTCGCCGACCACTCCCTGCACCTAAGCAAAGCGAAGATTTCCAAGCCAGCGCCCTACTGGGAAGGAACAGCTGTGATCGATGGAGAATTTAAGGAGCTGAAGTTAACTGATTATCGTGGGAAATACTTGGTTTTCTTCTTCTACCCACTTGATTTCACATTTGTGTGTCCAACTGAAATTATCGCTTTTGGCGACAGACTTGAAGAATTCAGATCTATAAATACTGAAGTGGTAGCATGCTCTGTTGATTCACAGTTTACCCATTTGGCCTGGATTAATACCCCTCGAAGACAAGGAGGACTTGGGCCAATAAGGATTCCACTTCTTTCAGATTTGACCCATCAGATCTCAAAGGACTATGGTGTATACCTAGAGGACTCAGGCCACACTCTTAGAGGTCTCTTCATTATTGATGACAAAGGAATCCTAAGACAAATTACTCTGAATGATCTTCCTGTGGGTAGATCAGTGGATGAGACACTACGTTTGGTTCAAGCATTCCAGTACACTGACAAACACGGAGAAGTCTGCCCTGCTGGCTGGAAACCTGGTAGTGAAACAATAATCCCAGATCCAGCTGGAAAGCTGAAGTATTTCGATAAACTGAATTGA |
ORF Protein Sequence | MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T76888-Ab | Anti-PRDX4/ AOE37-2/ AOE372 functional antibody |
Target Antigen | GM-Tg-g-T76888-Ag | PRDX4 protein |
ORF Viral Vector | pGMLP000443 | Human PRDX4 Lentivirus plasmid |
ORF Viral Vector | vGMLP000443 | Human PRDX4 Lentivirus particle |
Target information
Target ID | GM-T76888 |
Target Name | PRDX4 |
Gene ID | 10549, 53381, 697635, 85274, 101093082, 119868403, 281999, 100059985 |
Gene Symbol and Synonyms | AOE37-2,AOE372,HEL-S-97n,PRDX4,PRX-4,Prx-iv,Prx4,TRANK |
Uniprot Accession | Q13162 |
Uniprot Entry Name | PRDX4_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Breast Cancer |
Gene Ensembl | ENSG00000123131 |
Target Classification | Not Available |
The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.