Human TMEM187/CXorf12/DXS9878E ORF/cDNA clone-Lentivirus particle (NM_003492)

Cat. No.: vGMLP000564

Pre-made Human TMEM187/CXorf12/DXS9878E Lentiviral expression plasmid for TMEM187 lentivirus packaging, TMEM187 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMEM187/CXorf12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000564 Human TMEM187 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000564
Gene Name TMEM187
Accession Number NM_003492
Gene ID 8269
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 786 bp
Gene Alias CXorf12,DXS9878E,ITBA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATCCAGAGTGGGGGCAGGCCTTCGTGCACGTGGCCGTGGCCGGTGGCCTCTGTGCCGTGGCTGTGTTCACGGGCATTTTCGACAGTGTTTCCGTGCAAGTGGGCTATGAGCACTACGCCGAGGCGCCCGTGGCCGGCCTCCCTGCCTTCCTGGCCATGCCGTTCAACTCACTCGTGAACATGGCCTACACGCTGCTGGGGCTGTCGTGGCTGCACAGGGGCGGCGCGATGGGGCTGGGTCCCCGCTACCTGAAGGACGTGTTCGCAGCCATGGCCCTGCTCTATGGCCCCGTGCAGTGGCTGCGCCTGTGGACGCAGTGGCGCCGTGCCGCGGTGCTGGACCAGTGGCTCACACTGCCCATCTTTGCATGGCCCGTGGCCTGGTGCCTCTACCTAGACCGCGGCTGGCGGCCCTGGCTGTTCCTCTCTCTTGAGTGCGTCTCCCTGGCCAGTTATGGCCTCGCTCTGCTGCATCCCCAGGGCTTCGAGGTCGCACTGGGTGCTCACGTGGTGGCCGCTGTGGGGCAGGCGCTGCGCACCCACAGGCACTATGGCAGCACCACCTCGGCTACCTACTTAGCTTTGGGGGTGCTCTCTTGCCTGGGCTTTGTGGTCCTCAAGCTGTGTGACCATCAGCTCGCACGGTGGCGTCTCTTCCAGTGCCTCACAGGCCACTTCTGGTCCAAGGTCTGTGACGTGCTCCAGTTCCACTTTGCGTTTTTGTTTCTGACGCATTTCAACACTCACCCAAGATTCCATCCCTCTGGCGGGAAGACGCGTTGA
ORF Protein Sequence MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLVNMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTLPIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFAFLFLTHFNTHPRFHPSGGKTR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2028-Ab Anti-TMEM187 monoclonal antibody
    Target Antigen GM-Tg-g-IP2028-Ag TMEM187 protein
    ORF Viral Vector pGMLP000564 Human TMEM187 Lentivirus plasmid
    ORF Viral Vector vGMLP000564 Human TMEM187 Lentivirus particle


    Target information

    Target ID GM-IP2028
    Target Name TMEM187
    Gene ID 8269, 698397, 101090246, 612536, 508380, 100059186
    Gene Symbol and Synonyms CXorf12,DXS9878E,ITBA1,TMEM187
    Uniprot Accession Q14656
    Uniprot Entry Name TM187_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000177854
    Target Classification Not Available

    This gene consists of two exons and encodes a multi-pass membrane protein. An alternatively spliced transcript variant encoding the same protein has been found, but its biological validity is not determined. [provided by RefSeq, May 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.