Human PLAC9 ORF/cDNA clone-Lentivirus particle (NM_001012973)

Cat. No.: vGMLP000613

Pre-made Human PLAC9/ Lentiviral expression plasmid for PLAC9 lentivirus packaging, PLAC9 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PLAC9/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000613 Human PLAC9 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000613
Gene Name PLAC9
Accession Number NM_001012973
Gene ID 219348
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 294 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGCCCCTGCTCTGCGCGCTGACCGGACTGGCCCTGCTCCGCGCCGCGGGCTCTTTGGCCGCTGCCGAACCCTTCAGCCCTCCGCGAGGAGACTCAGCTCAGAGCACAGCGTGTGACAGACACATGGCTGTGCAACGCCGTCTAGATGTCATGGAGGAGATGGTAGAGAAGACCGTGGATCACCTGGGGACAGAGGTGAAAGGCCTGCTGGGCCTGCTGGAGGAGCTGGCCTGGAACCTGCCCCCGGGACCCTTCAGCCCCGCTCCCGACCTTCTCGGAGATGGCTTCTGA
ORF Protein Sequence MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1193-Ab Anti-PLAC9 functional antibody
    Target Antigen GM-Tg-g-SE1193-Ag PLAC9 protein
    ORF Viral Vector pGMLP000613 Human PLAC9 Lentivirus plasmid
    ORF Viral Vector vGMLP000613 Human PLAC9 Lentivirus particle


    Target information

    Target ID GM-SE1193
    Target Name PLAC9
    Gene ID 219348, 211623, 114669722, 361105, 101100336, 119871489, 510496, 100073023
    Gene Symbol and Synonyms Gm10393,Gm9780,PLAC9,Plac9a,Plac9b
    Uniprot Accession Q5JTB6
    Uniprot Entry Name PLAC9_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000189129
    Target Classification Not Available

    Predicted to be located in extracellular region. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.