Human CST6 ORF/cDNA clone-Lentivirus particle (NM_001323)

Cat. No.: vGMLP000726

Pre-made Human CST6/ Lentiviral expression plasmid for CST6 lentivirus packaging, CST6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CST6/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000726 Human CST6 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000726
Gene Name CST6
Accession Number NM_001323
Gene ID 1474
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 450 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCGTTCGAACCTCCCGCTGGCGCTGGGCCTGGCCCTGGTCGCATTCTGCCTCCTGGCGCTGCCACGCGACGCCCGGGCCCGGCCGCAGGAGCGCATGGTCGGAGAACTCCGGGACCTGTCGCCCGACGACCCGCAGGTGCAGAAGGCGGCGCAGGCGGCCGTGGCCAGCTACAACATGGGCAGCAACAGCATCTACTACTTCCGAGACACGCACATCATCAAGGCGCAGAGCCAGCTGGTGGCCGGCATCAAGTACTTCCTGACGATGGAGATGGGGAGCACAGACTGCCGCAAGACCAGGGTCACTGGAGACCACGTCGACCTCACCACTTGCCCCCTGGCAGCAGGGGCGCAGCAGGAGAAGCTGCGCTGTGACTTTGAGGTCCTTGTGGTTCCCTGGCAGAACTCCTCTCAGCTCCTAAAGCACAACTGTGTGCAGATGTGA
ORF Protein Sequence MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0581-Ab Anti-CYTM/ CST6 functional antibody
    Target Antigen GM-Tg-g-SE0581-Ag CST6 protein
    ORF Viral Vector pGMLP000726 Human CST6 Lentivirus plasmid
    ORF Viral Vector vGMLP000726 Human CST6 Lentivirus particle


    Target information

    Target ID GM-SE0581
    Target Name CST6
    Gene ID 1474, 73720, 714999, 171096, 101098336, 483719, 503685, 100057960
    Gene Symbol and Synonyms 1110017E11Rik,CST6,ECTD15,ichq
    Uniprot Accession Q15828
    Uniprot Entry Name CYTM_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Ovary Cancer, Chronic Kidney Disease
    Gene Ensembl ENSG00000175315
    Target Classification Not Available

    The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.