Human BET1/HBET1 ORF/cDNA clone-Lentivirus particle (NM_005868)

Cat. No.: vGMLP000831

Pre-made Human BET1/HBET1 Lentiviral expression plasmid for BET1 lentivirus packaging, BET1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to BET1/HBET1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000831 Human BET1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000831
Gene Name BET1
Accession Number NM_005868
Gene ID 10282
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 357 bp
Gene Alias HBET1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCGTGCAGGCCTGGGTGAAGGAGTACCTCCTGGCAACTATGGGAACTATGGCTATGCTAATAGTGGGTATAGTGCCTGTGAAGAAGAAAATGAGAGGCTCACTGAAAGTCTGAGAAGCAAAGTAACTGCTATAAAATCTCTTTCCATTGAAATAGGCCATGAAGTTAAAACCCAGAATAAATTATTAGCTGAAATGGATTCACAATTTGATTCCACAACTGGATTTCTAGGTAAAACTATGGGCAAACTGAAGATTTTATCCAGAGGGAGCCAAACAAAGCTGCTGTGCTATATGATGCTGTTTTCTTTATTTGTCTTTTTTATCATTTATTGGATTATTAAACTGAGGTGA
ORF Protein Sequence MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0418-Ab Anti-BET1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0418-Ag BET1 protein
    ORF Viral Vector pGMLP000831 Human BET1 Lentivirus plasmid
    ORF Viral Vector vGMLP000831 Human BET1 Lentivirus particle


    Target information

    Target ID GM-IP0418
    Target Name BET1
    Gene ID 10282, 12068, 700492, 29631, 101089179, 475231, 616526, 100051572
    Gene Symbol and Synonyms Bet-1,BET1,HBET1
    Uniprot Accession O15155
    Uniprot Entry Name BET1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000105829
    Target Classification Not Available

    This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.