Human FOLR3/FR-G/FR-gamma ORF/cDNA clone-Lentivirus particle (NM_000804)

Cat. No.: vGMLP000846

Pre-made Human FOLR3/FR-G/FR-gamma Lentiviral expression plasmid for FOLR3 lentivirus packaging, FOLR3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to FOLR3/FR-G products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000846 Human FOLR3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000846
Gene Name FOLR3
Accession Number NM_000804
Gene ID 2352
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 738 bp
Gene Alias FR-G,FR-gamma,gamma-hFR
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACATGGCCTGGCAGATGATGCAGCTGCTGCTTCTGGCTTTGGTGACTGCTGCGGGGAGTGCCCAGCCCAGGAGTGCGCGGGCCAGGACGGACCTGCTCAATGTCTGCATGAACGCCAAGCACCACAAGACACAGCCCAGCCCCGAGGACGAGCTGTATGGCCAGTGCAGTCCCTGGAAGAAGAATGCCTGCTGCACGGCCAGCACCAGCCAGGAGCTGCACAAGGACACCTCCCGCCTGTACAACTTTAACTGGGATCACTGTGGTAAGATGGAACCCACCTGCAAGCGCCACTTTATCCAGGACAGCTGTCTCTATGAGTGCTCACCCAACCTGGGGCCCTGGATCCGGCAGGTCAACCAGAGCTGGCGCAAAGAGCGCATTCTGAACGTGCCCCTGTGCAAAGAGGACTGTGAGCGCTGGTGGGAGGACTGTCGCACCTCCTACACCTGCAAAAGCAACTGGCACAAAGGCTGGAATTGGACCTCAGGGATTAATGAGTGTCCGGCCGGGGCCCTCTGCAGCACCTTTGAGTCCTACTTCCCCACTCCAGCCGCCCTTTGTGAAGGCCTCTGGAGCCACTCCTTCAAGGTCAGCAACTATAGTCGAGGGAGCGGCCGCTGCATCCAGATGTGGTTTGACTCAGCCCAGGGCAACCCCAATGAGGAGGTGGCCAAGTTCTATGCTGCGGCCATGAATGCTGGGGCCCCGTCTCGTGGGATTATTGATTCCTGA
ORF Protein Sequence MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T78332-Ab Anti-FOLR3/ FR-G/ FR-gamma functional antibody
    Target Antigen GM-Tg-g-T78332-Ag FOLR3 protein
    ORF Viral Vector pGMLP000846 Human FOLR3 Lentivirus plasmid
    ORF Viral Vector vGMLP000846 Human FOLR3 Lentivirus particle


    Target information

    Target ID GM-T78332
    Target Name FOLR3
    Gene ID 2352
    Gene Symbol and Synonyms FOLR3,FR-G,FR-gamma,FRgamma,gamma-hFR
    Uniprot Accession P41439
    Uniprot Entry Name FOLR3_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000110203
    Target Classification Not Available

    This gene encodes a member of the folate receptor (FOLR) family of proteins, which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. Expression of this gene may be elevated in ovarian and primary peritoneal carcinoma. This gene is present in a gene cluster on chromosome 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.