Human SNN ORF/cDNA clone-Lentivirus particle (NM_003498)

Cat. No.: vGMLP000852

Pre-made Human SNN/ Lentiviral expression plasmid for SNN lentivirus packaging, SNN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SNN/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000852 Human SNN Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000852
Gene Name SNN
Accession Number NM_003498
Gene ID 8303
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 267 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTATTATGGACCACAGCCCCACCACGGGCGTGGTCACAGTCATCGTCATCCTCATTGCCATCGCGGCCCTGGGGGCCTTGATCCTGGGCTGCTGGTGCTACCTGCGGCTGCAGCGCATCAGCCAGTCAGAGGACGAGGAGAGCATCGTGGGGGATGGGGAGACCAAGGAACCCTTCCTGCTGGTGCAGTATTCGGCCAAGGGACCGTGCGTGGAGAGAAAGGCCAAGCTGATGACTCCCAACGGCCCGGAAGTCCACGGCTGA
ORF Protein Sequence MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1780-Ab Anti-SNN monoclonal antibody
    Target Antigen GM-Tg-g-IP1780-Ag SNN protein
    ORF Viral Vector pGMLP000852 Human SNN Lentivirus plasmid
    ORF Viral Vector vGMLP000852 Human SNN Lentivirus particle


    Target information

    Target ID GM-IP1780
    Target Name SNN
    Gene ID 8303, 20621, 711909, 29140, 101083312, 609847, 615361, 100051037
    Gene Symbol and Synonyms 2810407J07Rik,SNN
    Uniprot Accession O75324
    Uniprot Entry Name SNN_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000184602
    Target Classification Not Available

    Enables metal ion binding activity. Predicted to be involved in response to toxic substance. Located in cytoplasm. Is integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.