Human GLRX2/CGI-133/GRX2 ORF/cDNA clone-Lentivirus particle (NM_016066)

Cat. No.: vGMLP000953

Pre-made Human GLRX2/CGI-133/GRX2 Lentiviral expression plasmid for GLRX2 lentivirus packaging, GLRX2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GLRX2/CGI-133 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000953 Human GLRX2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000953
Gene Name GLRX2
Accession Number NM_016066
Gene ID 51022
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 498 bp
Gene Alias CGI-133,GRX2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACCCTCGAGATAAGCAAGTGAGCCGCTTCTCCCCTCTAAAGGATGTTTACACGTGGGTGGCACTCGCTGGAATCCAGCGCTCGGGCAGCCCTGGGAGGACGCGCTCAGCTGCGAGGAGGATGGAGAGCAATACATCATCATCTTTGGAGAATTTAGCGACGGCGCCTGTGAACCAGATCCAAGAAACAATTTCTGATAATTGTGTGGTGATTTTCTCAAAAACATCCTGTTCTTACTGTACAATGGCAAAAAAGCTTTTCCATGACATGAATGTTAACTATAAAGTGGTGGAACTGGACCTGCTTGAATATGGAAACCAGTTCCAAGATGCTCTTTACAAAATGACTGGTGAAAGAACTGTTCCAAGAATATTTGTCAATGGTACTTTTATTGGAGGTGCAACTGACACTCATAGGCTTCACAAAGAAGGAAAATTGCTCCCACTAGTTCATCAGTGTTATTTAAAAAAAAGTAAGAGGAAAGAATTTCAGTGA
ORF Protein Sequence MNPRDKQVSRFSPLKDVYTWVALAGIQRSGSPGRTRSAARRMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T74425-Ab Anti-GLRX2 monoclonal antibody
    Target Antigen GM-Tg-g-T74425-Ag GLRX2 protein
    ORF Viral Vector pGMLP000953 Human GLRX2 Lentivirus plasmid
    ORF Viral Vector vGMLP000953 Human GLRX2 Lentivirus particle


    Target information

    Target ID GM-T74425
    Target Name GLRX2
    Gene ID 51022, 69367, 712396, 114022, 101091421, 478956, 513762, 100630466
    Gene Symbol and Synonyms 1700010P22Rik,CGI-133,GLRX2,GRX2
    Uniprot Accession Q9NS18
    Uniprot Entry Name GLRX2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000023572
    Target Classification Not Available

    The protein encoded by this gene is a member of the glutaredoxin family of proteins, which maintain cellular thiol homeostasis. These proteins are thiol-disulfide oxidoreductases that use a glutathione-binding site and one or two active cysteines in their active site. This gene undergoes alternative splicing to produce multiple isoforms, one of which is ubiquitously expressed and localizes to mitochondria, where it functions in mitochondrial redox homeostasis and is important for the protection against and recovery from oxidative stress. Other isoforms, which have more restrictive expression patterns, show cytosolic and nuclear localization, and are thought to function in cellular differentiation and transformation, possibly with a role in tumor progression. [provided by RefSeq, Aug 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.