Human SSPN/DAGA5/KRAG ORF/cDNA clone-Lentivirus particle (NM_005086)

Cat. No.: vGMLP000998

Pre-made Human SSPN/DAGA5/KRAG Lentiviral expression plasmid for SSPN lentivirus packaging, SSPN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SSPN/DAGA5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000998 Human SSPN Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000998
Gene Name SSPN
Accession Number NM_005086
Gene ID 8082
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 732 bp
Gene Alias DAGA5,KRAG,NSPN,SPN1,SPN2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCAAGAACAAGCAGCCACGCGGCCAGCAGAGGCAGGGGGGCCCGCCGGCCGCGGACGCCGCTGGGCCCGACGACATGGAGCCGAAGAAGGGCACGGGGGCCCCCAAGGAGTGCGGGGAGGAGGAGCCCCGGACCTGCTGCGGCTGCCGGTTCCCGCTGCTGCTCGCCCTGCTGCAGCTGGCCCTGGGCATCGCCGTGACCGTGGTGGGCTTCCTCATGGCGAGCATCAGCTCCTCCCTGCTAGTCAGGGACACTCCATTTTGGGCTGGGATCATTGTCTGCTTAGTGGCCTATCTTGGCTTGTTTATGCTTTGTGTCTCATATCAGGTTGACGAACGGACATGTATTCAATTTTCTATGAAACTGTTATACTTTCTGCTGAGTGCCCTGGGCCTGACGGTCTGTGTGCTGGCCGTGGCCTTTGCCGCCCACCACTATTCGCAGCTCACACAGTTTACCTGTGAGACCACACTCGACTCTTGCCAGTGCAAACTGCCCTCCTCGGAGCCGCTCAGCAGGACCTTTGTTTACCGGGATGTGACGGACTGTACCAGCGTCACTGGCACTTTCAAACTGTTCTTACTCATCCAGATGATTCTTAATTTGGTCTGCGGCCTTGTGTGCTTGTTGGCCTGCTTTGTGATGTGGAAACATAGGTACCAGGTCTTCTATGTGGGTGTCAGGATATGCTCCCTCACGGCTTCCGAAGGCCCCCAGCAAAAGATCTAA
ORF Protein Sequence MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1823-Ab Anti-SSPN monoclonal antibody
    Target Antigen GM-Tg-g-IP1823-Ag SSPN protein
    ORF Viral Vector pGMLP000998 Human SSPN Lentivirus plasmid
    ORF Viral Vector vGMLP000998 Human SSPN Lentivirus particle


    Target information

    Target ID GM-IP1823
    Target Name SSPN
    Gene ID 8082, 16651, 708482, 500364, 101098965, 100684937, 613989, 100068995
    Gene Symbol and Synonyms DAGA5,Gm32675,KRAG,NSPN,RGD1559723,SPN1,SPN2,SSPN
    Uniprot Accession Q14714
    Uniprot Entry Name SSPN_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000123096
    Target Classification Not Available

    This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.