Human SSPN/DAGA5/KRAG ORF/cDNA clone-Lentivirus particle (NM_005086)
Cat. No.: vGMLP000998
Pre-made Human SSPN/DAGA5/KRAG Lentiviral expression plasmid for SSPN lentivirus packaging, SSPN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SSPN/DAGA5 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000998 | Human SSPN Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000998 |
Gene Name | SSPN |
Accession Number | NM_005086 |
Gene ID | 8082 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 732 bp |
Gene Alias | DAGA5,KRAG,NSPN,SPN1,SPN2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCAAGAACAAGCAGCCACGCGGCCAGCAGAGGCAGGGGGGCCCGCCGGCCGCGGACGCCGCTGGGCCCGACGACATGGAGCCGAAGAAGGGCACGGGGGCCCCCAAGGAGTGCGGGGAGGAGGAGCCCCGGACCTGCTGCGGCTGCCGGTTCCCGCTGCTGCTCGCCCTGCTGCAGCTGGCCCTGGGCATCGCCGTGACCGTGGTGGGCTTCCTCATGGCGAGCATCAGCTCCTCCCTGCTAGTCAGGGACACTCCATTTTGGGCTGGGATCATTGTCTGCTTAGTGGCCTATCTTGGCTTGTTTATGCTTTGTGTCTCATATCAGGTTGACGAACGGACATGTATTCAATTTTCTATGAAACTGTTATACTTTCTGCTGAGTGCCCTGGGCCTGACGGTCTGTGTGCTGGCCGTGGCCTTTGCCGCCCACCACTATTCGCAGCTCACACAGTTTACCTGTGAGACCACACTCGACTCTTGCCAGTGCAAACTGCCCTCCTCGGAGCCGCTCAGCAGGACCTTTGTTTACCGGGATGTGACGGACTGTACCAGCGTCACTGGCACTTTCAAACTGTTCTTACTCATCCAGATGATTCTTAATTTGGTCTGCGGCCTTGTGTGCTTGTTGGCCTGCTTTGTGATGTGGAAACATAGGTACCAGGTCTTCTATGTGGGTGTCAGGATATGCTCCCTCACGGCTTCCGAAGGCCCCCAGCAAAAGATCTAA |
ORF Protein Sequence | MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1823-Ab | Anti-SSPN monoclonal antibody |
Target Antigen | GM-Tg-g-IP1823-Ag | SSPN protein |
ORF Viral Vector | pGMLP000998 | Human SSPN Lentivirus plasmid |
ORF Viral Vector | vGMLP000998 | Human SSPN Lentivirus particle |
Target information
Target ID | GM-IP1823 |
Target Name | SSPN |
Gene ID | 8082, 16651, 708482, 500364, 101098965, 100684937, 613989, 100068995 |
Gene Symbol and Synonyms | DAGA5,Gm32675,KRAG,NSPN,RGD1559723,SPN1,SPN2,SSPN |
Uniprot Accession | Q14714 |
Uniprot Entry Name | SSPN_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000123096 |
Target Classification | Not Available |
This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.