Human PRKAB1/AMPK/HAMPKb ORF/cDNA clone-Lentivirus particle (NM_006253)

Cat. No.: vGMLP001018

Pre-made Human PRKAB1/AMPK/HAMPKb Lentiviral expression plasmid for PRKAB1 lentivirus packaging, PRKAB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PRKAB1/AMPK products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001018 Human PRKAB1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001018
Gene Name PRKAB1
Accession Number NM_006253
Gene ID 5564
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 813 bp
Gene Alias AMPK,HAMPKb
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCAATACCAGCAGTGAGCGCGCCGCGCTGGAGCGGCATGGTGGCCATAAGACGCCCCGGAGGGACAGCTCGGGGGGCACCAAGGACGGGGACAGGCCCAAGATCCTGATGGACAGCCCCGAAGACGCCGACCTCTTCCACTCCGAGGAAATCAAGGCACCAGAGAAGGAGGAATTCCTGGCCTGGCAGCATGATCTGGAAGTGAATGATAAAGCTCCCGCCCAGGCTCGGCCAACGGTGTTTCGATGGACGGGGGGCGGAAAGGAAGTTTACTTATCTGGGTCCTTCAACAACTGGAGTAAACTTCCCCTCACCAGAAGCCACAATAACTTTGTAGCCATCCTGGATCTGCCGGAAGGAGAGCATCAGTACAAGTTCTTTGTGGATGGTCAGTGGACGCACGACCCTTCCGAGCCCATAGTAACCAGCCAGCTTGGCACAGTTAACAACATCATTCAAGTGAAGAAAACTGACTTTGAAGTATTTGATGCTTTAATGGTGGATTCCCAAAAGTGCTCCGATGTGTCTGAGCTGTCCAGTTCTCCCCCAGGACCCTACCATCAGGAGCCCTACGTCTGCAAACCCGAAGAGCGCTTTCGGGCACCCCCTATTCTCCCCCCACATCTCCTCCAGGTCATCCTGAACAAGGACACGGGGATTTCCTGTGATCCAGCTTTGCTTCCTGAGCCCAATCACGTCATGCTGAACCACCTATACGCGCTGTCTATCAAGGATGGAGTGATGGTGCTCAGCGCAACCCACCGGTACAAGAAGAAGTACGTCACCACCTTGTTATACAAGCCCATATGA
ORF Protein Sequence MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA082-Ab Anti-PRKAB1 monoclonal antibody
    Target Antigen GM-Tg-g-TA082-Ag PRKAB1 protein
    ORF Viral Vector pGMLP001018 Human PRKAB1 Lentivirus plasmid
    ORF Viral Vector pGMLP005189 Human PRKAB1 Lentivirus plasmid
    ORF Viral Vector pGMLP005644 Human PRKAB1 Lentivirus plasmid
    ORF Viral Vector pGMPC001334 Human PRKAB1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP001018 Human PRKAB1 Lentivirus particle
    ORF Viral Vector vGMLP005189 Human PRKAB1 Lentivirus particle
    ORF Viral Vector vGMLP005644 Human PRKAB1 Lentivirus particle


    Target information

    Target ID GM-TA082
    Target Name PRKAB1
    Gene ID 5564, 19079, 695737, 83803, 101094051, 486295, 534107, 100034094
    Gene Symbol and Synonyms 1300015D22Rik,AMPK,E430008F22,HAMPKb,PRKAB1
    Uniprot Accession Q9Y478
    Uniprot Entry Name AAKB1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000111725
    Target Classification Not Available

    The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.