Human MTCP1/P13MTCP1/p8MTCP1 ORF/cDNA clone-Lentivirus particle (NM_001018025)
Cat. No.: vGMLP001185
Pre-made Human MTCP1/P13MTCP1/p8MTCP1 Lentiviral expression plasmid for MTCP1 lentivirus packaging, MTCP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
MTCP1/P13MTCP1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP001185 | Human MTCP1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP001185 |
| Gene Name | MTCP1 |
| Accession Number | NM_001018025 |
| Gene ID | 4515 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 324 bp |
| Gene Alias | P13MTCP1,p8MTCP1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCAGGAGAGGATGTGGGGGCTCCACCCGATCACCTCTGGGTTCACCAAGAGGGTATCTACCGCGACGAATACCAGCGCACGTGGGTGGCCGTCGTGGAAGAGGAGACGAGTTTCCTAAGGGCACGAGTCCAGCAAATTCAGGTTCCCTTAGGTGACGCAGCTAGGCCAAGTCACCTTCTTACCTCCCAGCTACCTCTCATGTGGCAACTCTACCCGGAGGAGCGCTACATGGATAACAACTCTCGCTTGTGGCAGATACAGCATCATTTAATGGTCAGGGGAGTACAGGAGCTGTTGCTTAAGCTTTTGCCTGATGACTAA |
| ORF Protein Sequence | MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP2609-Ab | Anti-MTCP1 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP2609-Ag | MTCP1 protein |
| ORF Viral Vector | pGMLP001185 | Human MTCP1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP001185 | Human MTCP1 Lentivirus particle |
Target information
| Target ID | GM-IP2609 |
| Target Name | MTCP1 |
| Gene ID | 4515, 17763, 703004, 498814, 101093255, 492265, 784937, 100062315 |
| Gene Symbol and Synonyms | MTCP1,MTCP1NB,P13MTCP1,p8MTCP1,RGD1561352,TCL1C |
| Uniprot Accession | P56278 |
| Uniprot Entry Name | MTCP1_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000214827 |
| Target Classification | Not Available |
This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq, Mar 2009]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


