Human MTCP1/P13MTCP1/p8MTCP1 ORF/cDNA clone-Lentivirus particle (NM_001018025)

Cat. No.: vGMLP001185

Pre-made Human MTCP1/P13MTCP1/p8MTCP1 Lentiviral expression plasmid for MTCP1 lentivirus packaging, MTCP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MTCP1/P13MTCP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001185 Human MTCP1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001185
Gene Name MTCP1
Accession Number NM_001018025
Gene ID 4515
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 324 bp
Gene Alias P13MTCP1,p8MTCP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGGAGAGGATGTGGGGGCTCCACCCGATCACCTCTGGGTTCACCAAGAGGGTATCTACCGCGACGAATACCAGCGCACGTGGGTGGCCGTCGTGGAAGAGGAGACGAGTTTCCTAAGGGCACGAGTCCAGCAAATTCAGGTTCCCTTAGGTGACGCAGCTAGGCCAAGTCACCTTCTTACCTCCCAGCTACCTCTCATGTGGCAACTCTACCCGGAGGAGCGCTACATGGATAACAACTCTCGCTTGTGGCAGATACAGCATCATTTAATGGTCAGGGGAGTACAGGAGCTGTTGCTTAAGCTTTTGCCTGATGACTAA
ORF Protein Sequence MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2609-Ab Anti-MTCP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP2609-Ag MTCP1 protein
    ORF Viral Vector pGMLP001185 Human MTCP1 Lentivirus plasmid
    ORF Viral Vector vGMLP001185 Human MTCP1 Lentivirus particle


    Target information

    Target ID GM-IP2609
    Target Name MTCP1
    Gene ID 4515, 17763, 703004, 498814, 101093255, 492265, 784937, 100062315
    Gene Symbol and Synonyms MTCP1,MTCP1NB,P13MTCP1,p8MTCP1,RGD1561352,TCL1C
    Uniprot Accession P56278
    Uniprot Entry Name MTCP1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000214827
    Target Classification Not Available

    This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq, Mar 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.