Human VTN/V75/VN ORF/cDNA clone-Lentivirus particle (NM_000638)
Cat. No.: vGMLP001205
Pre-made Human VTN/V75/VN Lentiviral expression plasmid for VTN lentivirus packaging, VTN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
VTN/V75 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP001205 | Human VTN Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP001205 |
| Gene Name | VTN |
| Accession Number | NM_000638 |
| Gene ID | 7448 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 1437 bp |
| Gene Alias | V75,VN,VNT |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCACCCCTGAGACCCCTTCTCATACTGGCCCTGCTGGCATGGGTTGCTCTGGCTGACCAAGAGTCATGCAAGGGCCGCTGCACTGAGGGCTTCAACGTGGACAAGAAGTGCCAGTGTGACGAGCTCTGCTCTTACTACCAGAGCTGCTGCACAGACTATACGGCTGAGTGCAAGCCCCAAGTGACTCGCGGGGATGTGTTCACTATGCCGGAGGATGAGTACACGGTCTATGACGATGGCGAGGAGAAAAACAATGCCACTGTCCATGAACAGGTGGGGGGCCCCTCCCTGACCTCTGACCTCCAGGCCCAGTCCAAAGGGAATCCTGAGCAGACACCTGTTCTGAAACCTGAGGAAGAGGCCCCTGCGCCTGAGGTGGGCGCCTCTAAGCCTGAGGGGATAGACTCAAGGCCTGAGACCCTTCATCCAGGGAGACCTCAGCCCCCAGCAGAGGAGGAGCTGTGCAGTGGGAAGCCCTTCGACGCCTTCACCGACCTCAAGAACGGTTCCCTCTTTGCCTTCCGAGGGCAGTACTGCTATGAACTGGACGAAAAGGCAGTGAGGCCTGGGTACCCCAAGCTCATCCGAGATGTCTGGGGCATCGAGGGCCCCATCGATGCCGCCTTCACCCGCATCAACTGTCAGGGGAAGACCTACCTCTTCAAGGGTAGTCAGTACTGGCGCTTTGAGGATGGTGTCCTGGACCCTGATTACCCCCGAAATATCTCTGACGGCTTCGATGGCATCCCGGACAACGTGGATGCAGCCTTGGCCCTCCCTGCCCATAGCTACAGTGGCCGGGAGCGGGTCTACTTCTTCAAGGGGAAACAGTACTGGGAGTACCAGTTCCAGCACCAGCCCAGTCAGGAGGAGTGTGAAGGCAGCTCCCTGTCGGCTGTGTTTGAACACTTTGCCATGATGCAGCGGGACAGCTGGGAGGACATCTTCGAGCTTCTCTTCTGGGGCAGAACCTCTGCTGGTACCAGACAGCCCCAGTTCATTAGCCGGGACTGGCACGGTGTGCCAGGGCAAGTGGACGCAGCCATGGCTGGCCGCATCTACATCTCAGGCATGGCACCCCGCCCCTCCTTGGCCAAGAAACAAAGGTTTAGGCATCGCAACCGCAAAGGCTACCGTTCACAACGAGGCCACAGCCGTGGCCGCAACCAGAACTCCCGCCGGCCATCCCGCGCCACGTGGCTGTCCTTGTTCTCCAGTGAGGAGAGCAACTTGGGAGCCAACAACTATGATGACTACAGGATGGACTGGCTTGTGCCTGCCACCTGTGAACCCATCCAGAGTGTCTTCTTCTTCTCTGGAGACAAGTACTACCGAGTCAATCTTCGCACACGGCGAGTGGACACTGTGGACCCTCCCTACCCACGCTCCATCGCTCAGTACTGGCTGGGCTGCCCAGCTCCTGGCCATCTGTAG |
| ORF Protein Sequence | MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0548-Ab | Anti-VTNC/ VTN/ V75 functional antibody |
| Target Antigen | GM-Tg-g-SE0548-Ag | VTN protein |
| ORF Viral Vector | pGMLP001205 | Human VTN Lentivirus plasmid |
| ORF Viral Vector | vGMLP001205 | Human VTN Lentivirus particle |
Target information
| Target ID | GM-SE0548 |
| Target Name | VTN |
| Gene ID | 7448, 22370, 708499, 29169, 101100765, 480621, 507525, 100059034 |
| Gene Symbol and Synonyms | Aa1018,V75,VN,VNT,VTN |
| Uniprot Accession | P04004 |
| Uniprot Entry Name | VTNC_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000109072 |
| Target Classification | Not Available |
The protein encoded by this gene functions in part as an adhesive glycoprotein. Differential expression of this protein can promote either cell adhesion or migration as it links cells to the extracellular matrix through a variety of ligands. These ligands include integrins, plasminogen activator inhibitor-1, and urokinase plasminogen activator receptor. This secreted protein can be present in the plasma as a monomer or dimer and forms a multimer in the extracellular matrix of several tissues. This protein also inhibits the membrane-damaging effect of the terminal cytolytic complement pathway and binds to several serpin serine protease inhibitors. This protein can also promote extracellular matrix degradation and thus plays a role in tumorigenesis. It is involved in a variety of other biological processes such as the regulation of the coagulation pathway, wound healing, and tissue remodeling. The heparin-binding domain of this protein give it anti-microbial properties. It is also a lipid binding protein that forms a principal component of high density lipoprotein. [provided by RefSeq, Aug 2020]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


