Human CTXN1/CTXN ORF/cDNA clone-Lentivirus particle (NM_206833)

Cat. No.: vGMLP001248

Pre-made Human CTXN1/CTXN Lentiviral expression plasmid for CTXN1 lentivirus packaging, CTXN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CTXN1/CTXN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001248 Human CTXN1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001248
Gene Name CTXN1
Accession Number NM_206833
Gene ID 404217
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 249 bp
Gene Alias CTXN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCGCGACGTGGACGCTGTCGCCGGAGCCCCTGCCGCCGTCGACGGGGCCCCCGGTGGGCGCGGGCCTGGACGCGGAGCAGCGCACGGTGTTCGCCTTCGTGCTCTGCCTGCTCGTGGTGCTGGTGCTGTTGATGGTGCGCTGCGTGCGCATCCTGCTCGACCCCTACAGCCGCATGCCCGCCTCGTCCTGGACCGACCACAAGGAGGCGCTCGAGCGCGGGCAGTTCGACTACGCGTTGGTGTGA
ORF Protein Sequence MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKEALERGQFDYALV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0626-Ab Anti-CTXN1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0626-Ag CTXN1 protein
    ORF Viral Vector pGMLP001248 Human CTXN1 Lentivirus plasmid
    ORF Viral Vector vGMLP001248 Human CTXN1 Lentivirus particle


    Target information

    Target ID GM-IP0626
    Target Name CTXN1
    Gene ID 404217, 330695, 706069, 29145, 101100187, 611574, 100125924, 111774204
    Gene Symbol and Synonyms cortexin-1,CTXN,CTXN1
    Uniprot Accession P60606
    Uniprot Entry Name CTXN1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000178531
    Target Classification Not Available

    Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.