Human SMIM7/C19orf42 ORF/cDNA clone-Lentivirus particle (NM_001300925)

Cat. No.: vGMLP001249

Pre-made Human SMIM7/C19orf42 Lentiviral expression plasmid for SMIM7 lentivirus packaging, SMIM7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SMIM7/C19orf42 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001249 Human SMIM7 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001249
Gene Name SMIM7
Accession Number NM_001300925
Gene ID 79086
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 312 bp
Gene Alias C19orf42
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATCGGAGACATCCTGCTGTTCGGGACGTTGCTGATGAATGCCGGGGCGGTGCTGAACTTTAAGCTGAAAAAGAAGGACACGCAGGGCTTTGGGGAGGAGTCCAGGGAGCCCAGCACAGGTGACAACATCCGGGAATTCTTGCTGAGCCTCAGATACTTTCGAATCTTCATCGCCCTGTGGAACATCTTCATGATGTTCTGCATGATTGTGCTGAGAAAACTCAAGCAGATTGCCTTTCCATCTAGCACTGGGGCCATAACTCTGATACTACTGTTAACGAATTGTGAGATTTGCTGTAAATGGATTTAG
ORF Protein Sequence MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMIVLRKLKQIAFPSSTGAITLILLLTNCEICCKWI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0477-Ab Anti-SMIM7/ C19orf42 functional antibody
    Target Antigen GM-Tg-g-SE0477-Ag SMIM7 protein
    ORF Viral Vector pGMLP001249 Human SMIM7 Lentivirus plasmid
    ORF Viral Vector vGMLP001249 Human SMIM7 Lentivirus particle


    Target information

    Target ID GM-SE0477
    Target Name SMIM7
    Gene ID 79086, 66818, 106994662, 688495, 101094828, 610216, 613429, 100069519
    Gene Symbol and Synonyms 9130011J15Rik,C19orf42,C20H19orf42,C7H19orf42,SMIM7
    Uniprot Accession Q9BQ49
    Uniprot Entry Name SMIM7_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000214046
    Target Classification Not Available

    Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.