Human SMIM7/C19orf42 ORF/cDNA clone-Lentivirus particle (NM_001300925)
Cat. No.: vGMLP001249
Pre-made Human SMIM7/C19orf42 Lentiviral expression plasmid for SMIM7 lentivirus packaging, SMIM7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SMIM7/C19orf42 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP001249 | Human SMIM7 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP001249 |
| Gene Name | SMIM7 |
| Accession Number | NM_001300925 |
| Gene ID | 79086 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 312 bp |
| Gene Alias | C19orf42 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGATCGGAGACATCCTGCTGTTCGGGACGTTGCTGATGAATGCCGGGGCGGTGCTGAACTTTAAGCTGAAAAAGAAGGACACGCAGGGCTTTGGGGAGGAGTCCAGGGAGCCCAGCACAGGTGACAACATCCGGGAATTCTTGCTGAGCCTCAGATACTTTCGAATCTTCATCGCCCTGTGGAACATCTTCATGATGTTCTGCATGATTGTGCTGAGAAAACTCAAGCAGATTGCCTTTCCATCTAGCACTGGGGCCATAACTCTGATACTACTGTTAACGAATTGTGAGATTTGCTGTAAATGGATTTAG |
| ORF Protein Sequence | MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMIVLRKLKQIAFPSSTGAITLILLLTNCEICCKWI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0477-Ab | Anti-SMIM7/ C19orf42 functional antibody |
| Target Antigen | GM-Tg-g-SE0477-Ag | SMIM7 protein |
| ORF Viral Vector | pGMLP001249 | Human SMIM7 Lentivirus plasmid |
| ORF Viral Vector | vGMLP001249 | Human SMIM7 Lentivirus particle |
Target information
| Target ID | GM-SE0477 |
| Target Name | SMIM7 |
| Gene ID | 79086, 66818, 106994662, 688495, 101094828, 610216, 613429, 100069519 |
| Gene Symbol and Synonyms | 9130011J15Rik,C19orf42,C20H19orf42,C7H19orf42,SMIM7 |
| Uniprot Accession | Q9BQ49 |
| Uniprot Entry Name | SMIM7_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000214046 |
| Target Classification | Not Available |
Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


