Human GNPTG/C16orf27/GNPTAG ORF/cDNA clone-Lentivirus particle (NM_032520)

Cat. No.: vGMLP001269

Pre-made Human GNPTG/C16orf27/GNPTAG Lentiviral expression plasmid for GNPTG lentivirus packaging, GNPTG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GNPTG/C16orf27 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001269 Human GNPTG Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001269
Gene Name GNPTG
Accession Number NM_032520
Gene ID 84572
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 918 bp
Gene Alias C16orf27,GNPTAG,LP2537,RJD9
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGGGGCTGGCGCGGCTCCTGTTGCTCCTCGGGCTCTCGGCCGGCGGGCCCGCGCCGGCAGGTGCAGCGAAGATGAAGGTGGTGGAGGAGCCCAACGCGTTTGGGGTGAACAACCCGTTCTTGCCTCAGGCCAGTCGCCTCCAGGCCAAGAGGGATCCTTCACCCGTGTCTGGACCCGTGCATCTCTTCCGACTCTCGGGCAAGTGCTTCAGCCTGGTGGAGTCCACGTACAAGTATGAGTTCTGCCCGTTCCACAACGTGACCCAGCACGAGCAGACCTTCCGCTGGAACGCCTACAGTGGGATCCTCGGCATCTGGCACGAGTGGGAGATCGCCAACAACACCTTCACGGGCATGTGGATGAGGGACGGTGACGCCTGCCGTTCCCGGAGCCGGCAGAGCAAGGTGGAGCTGGCGTGTGGAAAAAGCAACCGGCTGGCCCATGTGTCCGAGCCGAGCACCTGCGTCTACGCGCTGACGTTCGAGACCCCCCTCGTCTGCCACCCCCACGCCTTGCTAGTGTACCCAACCCTGCCAGAGGCCCTGCAGCGGCAGTGGGACCAGGTAGAGCAGGACCTGGCCGATGAGCTGATCACCCCCCAGGGCCATGAGAAGTTGCTGAGGACACTTTTTGAGGATGCTGGCTACTTAAAGACCCCAGAAGAAAATGAACCCACCCAGCTGGAGGGAGGTCCTGACAGCTTGGGGTTTGAGACCCTGGAAAACTGCAGGAAGGCTCATAAAGAACTCTCAAAGGAGATCAAAAGGCTGAAAGGTTTGCTCACCCAGCACGGCATCCCCTACACGAGGCCCACAGAAACTTCCAACTTGGAGCACTTGGGCCACGAGACGCCCAGAGCCAAGTCTCCAGAGCAGCTGCGGGGTGACCCAGGACTGCGTGGGAGTTTGTGA
ORF Protein Sequence MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0246-Ab Anti-GNPTG/ C16orf27/ GNPTAG functional antibody
    Target Antigen GM-Tg-g-SE0246-Ag GNPTG protein
    ORF Viral Vector pGMLP001269 Human GNPTG Lentivirus plasmid
    ORF Viral Vector vGMLP001269 Human GNPTG Lentivirus particle


    Target information

    Target ID GM-SE0246
    Target Name GNPTG
    Gene ID 84572, 214505, 722441, 287134, 101088293, 100856506, 508713, 100067580
    Gene Symbol and Synonyms 6430527N14Rik,A830081F19,C16orf27,GNPTAG,GNPTG,LP2537,Mdcp1,RJD9,Tce7
    Uniprot Accession Q9UJJ9
    Uniprot Entry Name GNPTG_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000090581
    Target Classification Not Available

    This gene encodes the gamma sunbunit of the N-acetylglucosamine-1-phosphotransferase complex. This hexameric complex, composed of alpha, beta and gamma subunits, catalyzes the first step in synthesis of a mannose 6-phosphate lysosomal recognition marker. This enzyme complex is necessary for targeting of lysosomal hydrolases to the lysosome. Mutations in the gene encoding the gamma subunit have been associated with mucolipidosis IIIC, also known as mucolipidosis III gamma.[provided by RefSeq, Feb 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.