Human TMBIM4/CGI-119/GAAP ORF/cDNA clone-Lentivirus particle (NM_001282610.1)

Cat. No.: vGMLP001274

Pre-made Human TMBIM4/CGI-119/GAAP Lentiviral expression plasmid for TMBIM4 lentivirus packaging, TMBIM4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMBIM4/CGI-119 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001274 Human TMBIM4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001274
Gene Name TMBIM4
Accession Number NM_001282610.1
Gene ID 51643
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 624 bp
Gene Alias CGI-119,GAAP,LFG4,S1R,ZPRO
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGCAGCGTGGCCTCCGCCACCGTGCACATCCGAATGGGTTCTCTTAACTACAGTGACTTCAACAGTTTTTTTATACTTTGAGTCTGTACGGACATTTGTACATGAGAGTCCTGCCTTAATTTTGCTGTTTGCCCTCGGATCTCTGGGTTTGATTTTTGCGTTGATTTTAAACAGACATAAGTATCCCCTTAACCTGTACCTACTTTTTGGATTTACGCTGTTGGAAGCTCTGACTGTGGCAGTTGTTGTTACTTTCTATGATGTATATATTATTCTGCAAGCTTTCATACTGACTACTACAGTATTTTTTGGTTTGACTGTGTATACTCTACAATCTAAGAAGGATTTCAGCAAATTTGGAGCAGGGCTGTTTGCTCTTTTGTGGATATTGTGCCTGTCAGGATTCTTGAAGTTTTTTTTTTATAGTGAGATAATGGAGTTGGTCTTAGCCGCTGCAGGAGCCCTTCTTTTCTGTGGATTCATCATCTATGACACACACTCACTGATGCATAAACTGTCACCTGAAGAGTACGTATTAGCTGCCATCAGCCTCTACTTGGATATCATCAATCTATTCCTGCACCTGTTACGGTTTCTGGAAGCAGTTAATAAAAAGTAA
ORF Protein Sequence MAAAWPPPPCTSEWVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1931-Ab Anti-TMBIM4 monoclonal antibody
    Target Antigen GM-Tg-g-IP1931-Ag TMBIM4 protein
    ORF Viral Vector pGMLP001274 Human TMBIM4 Lentivirus plasmid
    ORF Viral Vector vGMLP001274 Human TMBIM4 Lentivirus particle


    Target information

    Target ID GM-IP1931
    Target Name TMBIM4
    Gene ID 51643, 68212, 717825, 362884, 101090118, 474432, 513242, 100057978
    Gene Symbol and Synonyms 0610007H07Rik,CGI-119,Cgi119,GAAP,LFG4,S1R,TMBIM4,ZPRO
    Uniprot Accession Q9HC24
    Uniprot Entry Name LFG4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000155957
    Target Classification Not Available

    Involved in negative regulation of apoptotic process and regulation of calcium-mediated signaling. Located in Golgi stack. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.