Human MSI1 ORF/cDNA clone-Lentivirus particle (NM_002442)

Cat. No.: vGMLP001789

Pre-made Human MSI1/ Lentiviral expression plasmid for MSI1 lentivirus packaging, MSI1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MSI1/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001789 Human MSI1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001789
Gene Name MSI1
Accession Number NM_002442
Gene ID 4440
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1089 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGACTGACGCGCCCCAGCCCGGCCTCGCCTCCCCGGACTCGCCGCACGACCCCTGCAAGATGTTCATCGGGGGACTCAGTTGGCAGACTACGCAGGAAGGGCTGCGCGAATACTTCGGCCAGTTCGGGGAGGTGAAGGAGTGTCTGGTGATGCGGGACCCCCTGACCAAGAGATCCAGGGGTTTCGGCTTCGTCACTTTCATGGACCAGGCGGGGGTGGATAAAGTGCTGGCGCAATCGCGGCACGAGCTCGACTCCAAAACAATTGACCCTAAGGTGGCCTTCCCTCGGCGAGCACAGCCCAAGATGGTGACTCGAACGAAGAAGATCTTTGTGGGGGGGCTGTCGGTGAACACCACGGTGGAGGACGTGAAGCAATATTTTGAGCAGTTTGGGAAGGTGGACGACGCCATGCTGATGTTTGACAAAACCACCAACCGGCACCGAGGGTTCGGGTTTGTCACGTTTGAGAGTGAGGACATCGTGGAGAAAGTGTGTGAAATTCATTTTCATGAAATCAACAACAAAATGGTGGAATGTAAGAAAGCTCAGCCAAAGGAGGTGATGTCGCCAACGGGCTCAGCCCGGGGGAGGTCTCGAGTCATGCCCTACGGAATGGACGCCTTCATGCTGGGCATCGGCATGCTGGGTTACCCAGGTTTCCAAGCCACAACCTACGCCAGCCGGAGTTATACAGGCCTCGCCCCTGGCTACACCTACCAGTTCCCCGAATTCCGTGTAGAGCGGACCCCTCTCCCGAGCGCCCCAGTCCTCCCCGAGCTTACAGCCATTCCTCTCACTGCCTACGGACCAATGGCGGCGGCAGCGGCGGCAGCGGCTGTGGTTCGAGGGACAGGCTCTCACCCCTGGACGATGGCTCCCCCTCCAGGTTCGACTCCCAGCCGCACAGGGGGCTTCCTGGGGACCACCAGCCCCGGCCCCATGGCCGAGCTCTACGGGGCGGCCAACCAGGACTCGGGGGTCAGCAGTTACATCAGCGCCGCCAGCCCTGCCCCCAGCACCGGCTTCGGCCACAGTCTTGGGGGCCCTTTGATTGCCACAGCCTTCACCAATGGGTACCACTGA
ORF Protein Sequence METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T21715-Ab Anti-MSI1 monoclonal antibody
    Target Antigen GM-Tg-g-T21715-Ag MSI1 protein
    ORF Viral Vector pGMLP000826 Human MSI1 Lentivirus plasmid
    ORF Viral Vector pGMLP001789 Human MSI1 Lentivirus plasmid
    ORF Viral Vector vGMLP000826 Human MSI1 Lentivirus particle
    ORF Viral Vector vGMLP001789 Human MSI1 Lentivirus particle


    Target information

    Target ID GM-T21715
    Target Name MSI1
    Gene ID 4440, 17690, 699286, 259272, 101081170, 611488, 527436, 100053469
    Gene Symbol and Synonyms m-Msi-1,MSI1,Msi1h,Musahi1
    Uniprot Accession O43347
    Uniprot Entry Name MSI1H_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000135097
    Target Classification Not Available

    This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.